Recombinant Bovine Protein reprimo (RPRM)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Protein Reprimo (RPRM)

Recombinant Bovine Protein Reprimo (RPRM) is a synthetically produced version of the protein encoded by the RPRM gene in cattle. This protein is functionally analogous to its human counterpart, which regulates p53-dependent G2 cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2-cyclin B1 complex . Bovine RPRM is produced via recombinant DNA technology, often in bacterial (e.g., E. coli), yeast, or mammalian expression systems, enabling scalable production for research and therapeutic applications .

Gene and Protein Background

The RPRM gene is a tumor suppressor implicated in DNA damage response and cell cycle regulation. In humans, it is hypermethylated in cancers like gastric and pancreatic tumors, leading to reduced expression . Bovine RPRM shares conserved functional domains, including regions critical for its interaction with cyclin-dependent kinases and DNA repair machinery .

Key Features of Bovine RPRM

FeatureDescription
Gene LocationChromosome 2q23 (homologous to human locus)
Protein StructureSingle-pass membrane protein with cytoplasmic localization
FunctionInduces G2 arrest via CDK1 inhibition; involved in p53-mediated apoptosis
Expression SystemsE. coli, yeast, baculovirus, or mammalian cells (partial/full-length)

Recombinant Production and Applications

Recombinant bovine RPRM is produced in various formats, as detailed in Table 1. These proteins are validated for use in biochemical assays, cell culture studies, and structural biology .

Table 1: Bovine RPRM Recombinant Proteins

CodeProduct NameSource System
CSB-CF638455BOFull-length RPRME. coli
CSB-YP638455BO1Partial RPRM (Yeast)Yeast
CSB-EP638455BO1Partial RPRM (E. coli)E. coli
CSB-BP638455BO1Partial RPRM (Baculovirus)Baculovirus
CSB-MP638455BO1Partial RPRM (Mammalian)Mammalian cells

Applications

  1. Cell Cycle Studies: Used to investigate RPRM’s role in G2 arrest and CDK1 inhibition .

  2. Cancer Research: Serves as a model for studying tumor suppressor mechanisms in livestock or veterinary contexts.

  3. Therapeutic Development: Potential candidate for radiation-induced injury models, as RPRM deletion reduces DNA damage in irradiated tissues .

Therapeutic Potential and Challenges

Potential Applications

  • Radiation Injury: Bovine RPRM models could inform strategies to mitigate radiation-induced brain injury in livestock or veterinary medicine .

  • Cancer Therapeutics: Targeting RPRM’s methylation status (e.g., demethylating agents) may restore tumor suppressor activity .

Challenges

  • Species-Specific Validation: Bovine RPRM’s efficacy in human models remains untested.

  • Production Complexity: Full-length RPRM requires advanced expression systems (e.g., mammalian cells) for proper glycosylation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this requirement in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
RPRM; Protein reprimo
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MNPALGNQTDVAGLFLANSSEALERAMRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
Uniprot No.

Target Background

Function
Reprimo (RPRM) may be involved in the regulation of p53-dependent G2 arrest of the cell cycle. It appears to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex.
Database Links
Protein Families
Reprimo family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.

Q&A

What is Protein Reprimo (RPRM) and what are its key functions?

Protein Reprimo is the product of the single-exon RPRM gene located at chromosome 2q23, which encodes a highly glycosylated protein of 109 amino acids. RPRM functions primarily as a tumor suppressor through multiple mechanisms:

  • Acts as a secretory protein that induces extrinsic apoptosis in recipient cells

  • Mediates p53-dependent cell cycle arrest at the G2/M phase by inhibiting Cyclin B1·Cdc2 complex activation

  • Inhibits cell proliferation, colony formation, migration, and invasiveness of cancer cells

  • Participates in DNA damage response (DDR) pathways by negatively regulating ATM protein levels

RPRM has emerged as a crucial component in the newly identified p53–Reprimo–Hippo–YAP/TAZ–p73 axis that represents an extrinsic apoptosis pathway with a significant role in tumor suppression .

What expression systems are most effective for producing recombinant RPRM?

Recombinant RPRM can be successfully expressed and purified from several host systems, each with distinct advantages:

  • E. coli and yeast systems: Offer the highest protein yields and shorter production turnaround times, making them suitable for initial structural studies and applications requiring large quantities

  • Insect cells with baculovirus: Provide many essential post-translational modifications necessary for correct protein folding and moderate yields

  • Mammalian cell expression systems: Ensure the most physiologically relevant post-translational modifications and are recommended when protein activity must be precisely maintained

The choice of expression system should be determined by the specific research application, with consideration for glycosylation patterns that may be crucial for RPRM functionality.

How is RPRM expression regulated at the cellular level?

RPRM expression is regulated through multiple mechanisms:

  • Transcriptional regulation: RPRM is a direct target gene of p53 and is upregulated following DNA damage in p53-competent cells

  • Epigenetic regulation: The RPRM promoter is frequently silenced by aberrant DNA methylation in various cancers including breast, gastric, pituitary, and pancreatic cancers

  • Post-translational modification: RPRM is phosphorylated at serine 98 by CDK4/6, which appears to be involved in its nuclear translocation and interaction with ATM

  • Stress-induced expression: X-irradiation and other genotoxic agents can induce RPRM expression in a p53-dependent manner

Understanding these regulatory mechanisms is essential for experimental design when investigating RPRM's role in normal physiology and pathological conditions.

What is the mechanism by which secreted RPRM induces extrinsic apoptosis?

The extrinsic apoptosis pathway induced by secreted RPRM involves a complex signaling cascade:

  • Receptor binding: Secreted Reprimo protein binds to members of the protocadherin family, specifically identified as FAT1, FAT4, CELSR1, CELSR2, and CELSR3

  • Hippo pathway activation: Following receptor binding, RPRM activates the Hippo signaling pathway

  • YAP/TAZ regulation: The activated Hippo pathway leads to modulation of YAP/TAZ transcriptional co-activators

  • p73-mediated transcription: The Hippo–YAP/TAZ–p73 axis is engaged, resulting in the transactivation of various proapoptotic genes

  • Apoptosis execution: The upregulation of proapoptotic factors ultimately leads to programmed cell death in recipient cells

This pathway represents a novel extrinsic apoptosis mechanism distinct from the classical death receptor pathways and offers potential therapeutic applications in cancer treatment.

How does RPRM interact with the DNA damage response (DDR) pathway?

RPRM plays a multifaceted role in the DNA damage response pathway:

  • ATM regulation: RPRM negatively regulates ATM protein levels by promoting nuclear-cytoplasmic translocation of ATM, resulting in its degradation

  • Repair pathway inhibition: RPRM overexpression inhibits both homologous recombination (HR) and non-homologous end joining (NHEJ) DNA repair pathways

  • Nuclear translocation: Upon DNA damage, RPRM translocates to the nucleus where it interacts with ATM

  • Importin-mediated transport: The nuclear import of RPRM appears to involve Importin 11 (IPO11)

  • CDK4/6-mediated phosphorylation: Phosphorylation of RPRM at serine 98 by CDK4/6 is involved in its function within the DDR pathway

This regulatory relationship between RPRM and ATM suggests that modulating RPRM levels could potentially be utilized to sensitize cancer cells to radiotherapy and other DNA-damaging treatments.

What experimental approaches can be used to study RPRM's tumor-suppressive effects in vivo?

Several experimental approaches have been employed to investigate RPRM's tumor-suppressive functions in vivo:

  • Xenograft models: Implanting cells with controlled RPRM expression levels in immunodeficient mice to study tumor growth dynamics

  • Genetic knockout models: RPRM-knockout mice have been used to study the impact of RPRM deficiency on radiation sensitivity and tissue response to radiation injury

  • Whole-body irradiation (WBI): Used to evaluate the role of RPRM in radiation-induced systemic damage and survival

  • Whole-abdominal irradiation (WAI): Applied to assess RPRM's function in protecting specific tissues like intestinal epithelium from radiation damage

  • Recombinant protein administration: Direct administration of purified Reprimo protein into solid tumors to evaluate its ability to trigger apoptosis and suppress tumor growth

These approaches provide complementary insights into RPRM's functions in different physiological and pathological contexts.

What are the optimal conditions for expressing and purifying functional recombinant RPRM?

Optimizing recombinant RPRM production requires attention to several critical factors:

ParameterE. coli SystemInsect Cell SystemMammalian Cell System
Expression vectorpET series with T7 promoterBaculovirus with polyhedrin promoterpCMV vectors with strong viral promoters
Expression temperature16-25°C post-induction27°C37°C with 5% CO₂
Induction conditions0.1-0.5 mM IPTG, 16-20 hoursViral MOI 2-5, 48-72 hoursTransient or stable expression for 24-72 hours
Solubility enhancersAddition of 0.1% Triton X-100, 5-10% glycerolSerum-free media with supplementsDefined media with essential growth factors
Purification strategyIMAC followed by SECImmunoaffinity chromatographyMulti-step chromatography including IEX
Glycosylation considerationsNot applicablePartial glycosylation, may require enzymatic treatmentMost physiologically relevant glycosylation

For functional studies, mammalian expression systems are preferred due to their ability to produce correctly folded and post-translationally modified RPRM .

How can researchers effectively measure RPRM-induced apoptosis in experimental settings?

Quantifying RPRM-induced apoptosis requires multi-parameter assessment:

  • Morphological analysis:

    • Fluorescence microscopy with nuclear stains to visualize chromatin condensation

    • Transmission electron microscopy to observe ultrastructural changes

  • Biochemical assays:

    • Annexin V/PI dual staining followed by flow cytometry to distinguish early and late apoptotic cells

    • TUNEL assay to detect DNA fragmentation

    • Caspase-3/7 activity assays to measure executioner caspase activation

  • Molecular analyses:

    • Western blotting for cleaved PARP, cleaved caspases, and Bcl-2 family protein levels

    • RT-qPCR to quantify expression of apoptosis-related genes induced by the YAP/TAZ-p73 axis

    • ChIP assays to detect p73 binding to promoters of proapoptotic genes

  • Live-cell imaging:

    • Time-lapse microscopy with fluorescent probes for real-time monitoring of apoptotic events

    • FRET-based sensors to monitor caspase activation kinetics

When designing experiments, researchers should include both direct treatment with recombinant RPRM protein and conditional expression systems to comprehensively evaluate apoptotic mechanisms.

What approaches can be used to validate RPRM receptor binding and signaling?

Validating RPRM-receptor interactions and downstream signaling requires multiple complementary techniques:

  • Binding assays:

    • Surface Plasmon Resonance (SPR) to determine binding kinetics between purified RPRM and receptor ectodomains

    • Pull-down assays with tagged recombinant RPRM to identify interacting partners

    • Cross-linking followed by mass spectrometry to map interaction interfaces

  • Cellular validation:

    • Proximity ligation assay (PLA) to visualize RPRM-receptor interactions in situ

    • CRISPR-Cas9 knockout of putative receptors (FAT1, FAT4, CELSR1-3) followed by functional rescue

    • Receptor blocking antibodies to inhibit RPRM-induced effects

  • Signaling pathway analyses:

    • Phospho-specific antibodies to track Hippo pathway component activation

    • Luciferase reporter assays for TEAD-dependent transcription to measure YAP/TAZ activity

    • Co-immunoprecipitation to detect complex formation between YAP/TAZ and p73

  • Functional validation:

    • Domain deletion mutants to identify critical regions of RPRM for receptor binding

    • Structure-function studies with recombinant RPRM variants

    • Competitive displacement assays with peptide fragments

These approaches collectively provide robust evidence for the proposed p53–Reprimo–Hippo–YAP/TAZ–p73 signaling axis in apoptosis induction.

What are the key challenges in developing RPRM-based cancer therapeutics?

The development of RPRM-based cancer therapeutics faces several significant challenges:

  • Protein production and delivery:

    • Establishing cost-effective large-scale production of correctly folded RPRM

    • Developing effective delivery systems that can target RPRM to tumor sites

    • Ensuring stability of the protein in circulation and at the target site

  • Targeting considerations:

    • Identifying cancer types most susceptible to RPRM-induced apoptosis

    • Determining whether RPRM receptors are expressed in target tumors

    • Evaluating potential off-target effects on normal tissues expressing RPRM receptors

  • Resistance mechanisms:

    • Understanding potential adaptive responses that might limit efficacy

    • Identifying biomarkers that predict response to RPRM-based therapies

    • Developing combination strategies to overcome resistance

  • Translational gaps:

    • Validating in vitro findings in physiologically relevant in vivo models

    • Establishing appropriate dosing regimens and administration schedules

    • Developing reliable companion diagnostics for patient selection

The potential of administering Reprimo protein or small molecules that mimic its functional properties into solid tumors represents a promising therapeutic strategy that warrants further investigation .

How can RPRM's dual role in tumor suppression and radiosensitization be reconciled for therapeutic applications?

The dual functionality of RPRM presents both opportunities and challenges for therapeutic development:

  • Context-dependent targeting strategies:

    • For tumors with intact p53: Interventions to increase endogenous RPRM expression

    • For p53-mutant tumors: Direct delivery of recombinant RPRM or mimetics

    • For normal tissues during radiotherapy: Temporary RPRM inhibition to reduce radiosensitivity

  • Temporal considerations:

    • Sequential therapy approaches where RPRM modulation is timed relative to other treatments

    • Pulsed administration strategies to maximize tumor-specific effects

  • Molecular engineering approaches:

    • Development of tissue-specific RPRM variants with modified receptor binding profiles

    • Creation of conditionally active RPRM molecules that are activated in the tumor microenvironment

  • Combination therapies:

    • Integration with DNA damage-inducing agents to enhance RPRM-mediated apoptosis

    • Co-targeting of ATM to augment RPRM's effects on DNA repair pathways

    • Combination with epigenetic modifiers to reverse RPRM promoter methylation in cancers

These approaches require careful experimental validation to balance therapeutic efficacy with potential toxicity to normal tissues.

What controls are essential when conducting RPRM functional studies?

Rigorous RPRM research requires comprehensive controls to ensure valid interpretation of results:

  • Expression system controls:

    • Empty vector controls for all expression constructs

    • Inactive RPRM mutants (e.g., phosphorylation-site mutants)

    • Non-secreted RPRM variants (signal peptide deletions)

  • Cell line considerations:

    • Matched p53 wild-type and null/mutant cell lines

    • RPRM knockout cell lines created via CRISPR-Cas9

    • Cell lines with varying expression levels of identified RPRM receptors

  • Treatment controls:

    • Heat-inactivated RPRM protein

    • Conditioned media fractionation controls

    • Receptor-blocking antibody specificity controls

  • Pathway validation:

    • Pharmacological inhibitors of Hippo pathway components

    • YAP/TAZ knockdown or knockout models

    • p73-deficient cellular models

These controls help distinguish direct RPRM effects from indirect or non-specific effects and validate the proposed signaling mechanisms.

How can researchers address potential contradictions in RPRM functional data?

When encountering contradictory findings regarding RPRM function, researchers should consider:

  • Biological context variations:

    • Cell type-specific effects due to different receptor expression profiles

    • p53 status affecting RPRM induction and function

    • Differential pathway activation in various cellular contexts

  • Methodological reconciliation:

    • Standardization of recombinant RPRM production and quality control

    • Consistent definition and measurement of endpoints

    • Cross-validation using multiple methodological approaches

  • Dose and time-dependent responses:

    • Comprehensive dose-response studies with recombinant RPRM

    • Time-course analyses to distinguish immediate versus delayed effects

    • Consideration of biphasic responses across concentration ranges

  • Integration with existing literature:

    • Systematic comparison with published datasets

    • Meta-analysis approaches to identify consistent patterns

    • Collaboration with other research groups to resolve discrepancies

A particular area requiring careful interpretation is the seemingly contradictory role of RPRM in both promoting apoptosis while also contributing to radioresistance when knocked out in certain contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.