Recombinant Bovine Protein RER1 (RER1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is assigned during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
RER1; Protein RER1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
RER1
Target Protein Sequence
MSEGDSVGDSVHGKPSVVYRFFTRLGQIYQSWLDKSTPHTAVRWVVTLGLSFIYMIRVYL LQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFK FWHAATKGILVAMVCTFFEAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHG KRTYKGKEDAGKAFAS
Uniprot No.

Target Background

Function

Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.

Database Links
Protein Families
RER1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is RER1 and what is its primary function in cells?

RER1 (Retention in Endoplasmic Reticulum 1) is a well-conserved early-Golgi membrane protein that functions as an important retrieval receptor in the endoplasmic reticulum (ER)-Golgi trafficking system. The protein plays a crucial role in the quality control system of the early Golgi apparatus. RER1 was first identified in yeast as an ER retention factor for various proteins including Sec12p, Sed4p, Mns1p, Sec71p, and Sec63p . The primary function of RER1 is to bind to the transmembrane domains (TMDs) of specific proteins and facilitate their retrieval from the early-Golgi back to the ER via COPI-mediated retrograde transport pathways . This mechanism ensures proper assembly of protein complexes by retaining unassembled components in the ER until they form appropriate complexes with their partners, essentially acting as a sorting chaperone in the formation of multimeric membrane protein complexes .

What are the structural characteristics of bovine RER1?

Bovine RER1, like its human counterpart, is a member of the RER1 protein family with a predicted molecular weight of approximately 23 kDa. The protein contains specific transmembrane domains that enable its localization primarily in the early Golgi and ER-Golgi intermediate compartment. The C-terminal 25 amino acids are particularly important for RER1's correct localization and function in early secretory compartments . Research has demonstrated that mutant forms lacking this C-terminal region (RER1Δ25) show altered localization patterns and significantly reduced functional capacity . The protein possesses specific binding sites that recognize transmembrane domains of target proteins, allowing it to effectively mediate protein retention and retrieval. While bovine-specific structural data may vary slightly from human RER1, the high degree of conservation across species suggests similar structural features and functional domains.

How is recombinant RER1 typically produced and purified?

Recombinant RER1 protein can be produced through expression in mammalian cell systems such as HEK293T cells transfected with an RER1 cDNA clone . For purification and analysis, the recombinant protein is typically tagged with epitope tags such as C-Myc/DDK to facilitate detection and purification . The purified protein is commonly stored as a frozen solution in PBS buffer with a specific formulation (25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol) at -80°C to maintain stability . Proper storage conditions are crucial as the protein should be kept at -80°C and is reported to be stable for 12 months under appropriate storage and handling conditions . Researchers should avoid repeated freeze-thaw cycles to maintain protein integrity. Purity of greater than 80% can be achieved and verified using SDS-PAGE and Coomassie blue staining techniques .

What role does RER1 play in protein quality control and disease pathways?

RER1 functions as a critical component in the cellular protein quality control system by mediating the retrieval of immature or unassembled proteins from the Golgi back to the ER. Recent research has identified RER1 as an important factor in regulating levels of alpha-synuclein (αSyn), a protein implicated in Parkinson's disease and other synucleinopathies . RER1 overexpression significantly decreases levels of both wild-type and disease-causing mutants (A30P, A53T, and E46K) of αSyn . This effect appears to be specific to αSyn and mediated primarily through the ubiquitin-proteasome system (UPS) . Additionally, RER1 has been shown to interact with the ubiquitin ligase NEDD4, suggesting a mechanistic link between RER1 function and protein degradation pathways .

The protein has also been identified as an important regulator of γ-secretase complex formation and activity, which impacts Notch signaling during mouse cerebral cortex development . When RER1 is depleted, subpopulations of γ-secretase complexes and components are transported to and degraded in lysosomes, significantly reducing the amount of functional complex on the cell surface . This finding links RER1 function to neurodevelopmental processes and potentially to neurodegenerative disorders where γ-secretase and Notch signaling play important roles.

How does RER1's interaction with the COPI transport system influence experimental design?

RER1's function is intimately connected with the COPI-mediated retrograde transport system, which carries proteins from the Golgi back to the ER. This interaction has significant implications for experimental design when studying RER1. Researchers should consider incorporating COPI pathway inhibitors or co-immunoprecipitation assays with COPI components to fully understand RER1's trafficking functions. The C-terminal region of RER1 appears crucial for its correct localization and function, as demonstrated by the altered function of the RER1Δ25 mutant which may disrupt COPI coatomer binding necessary for its effects on target proteins like αSyn .

When designing experiments to study RER1 function, researchers should include appropriate controls that address potential alterations in the COPI pathway. This might involve using specific inhibitors of COPI vesicle formation or siRNA knockdown of key COPI components alongside RER1 manipulations. Additionally, subcellular fractionation techniques combined with immunofluorescence assays can help track the localization patterns of RER1 and its cargo proteins in relation to COPI vesicles. Understanding this interaction is essential for interpreting experimental results correctly, especially when studying RER1's effects on protein trafficking and degradation.

What are the key differences between RER1 orthologs across species and how might this affect recombinant bovine protein studies?

While RER1 is highly conserved across eukaryotes from yeast to mammals, subtle species-specific differences exist that may impact recombinant protein studies. RER1 was first characterized in yeast, where it functions alongside another protein, Bsd2, which shares substrates and has a similar role as a TMD-dependent ER retention factor . In mammalian systems, RER1 has evolved additional functions, including regulation of protein complexes like γ-secretase and modulation of signaling pathways like Notch .

When working with recombinant bovine RER1, researchers should consider potential differences in post-translational modifications, binding partners, and substrate specificity compared to human or yeast orthologs. These differences might affect functional assays, antibody recognition, and protein-protein interaction studies. Cross-species complementation experiments could provide valuable insights into the functional conservation of bovine RER1. Additionally, careful consideration should be given to the expression system used for recombinant production, as heterologous expression might not recapitulate all the native modifications and interactions of bovine RER1.

What are the optimal conditions for expressing soluble and functional recombinant RER1?

Achieving high yields of soluble, functional recombinant RER1 requires careful optimization of expression conditions. Based on experimental design approaches for recombinant protein expression, several factors should be considered . For mammalian expression systems such as HEK293T cells (which have been successfully used for RER1 expression), transfection efficiency, cell density at transfection, and post-transfection incubation time are critical parameters . Typical expression vectors include those with strong promoters like CMV, and inclusion of appropriate epitope tags such as C-Myc/DDK can facilitate detection and purification .

For bacterial expression systems, optimization through multivariate experimental design approaches may be beneficial . This would involve systematically varying factors such as induction temperature, inducer concentration, induction time, and media composition. Given RER1's transmembrane nature, additional considerations for membrane protein expression might be necessary, potentially including the use of specialized E. coli strains, fusion tags that enhance solubility, or detergent screening for extraction and purification. Experimental design methodology has been shown to achieve high levels (250 mg/L) of soluble expression of other recombinant proteins in E. coli, suggesting similar approaches could be adapted for RER1 .

What are the recommended methods for analyzing RER1-protein interactions in cellular contexts?

Analyzing RER1-protein interactions requires a combination of biochemical and imaging approaches. Co-immunoprecipitation (co-IP) has been effectively used to demonstrate interactions between RER1 and proteins like NEDD4 . For these assays, cells expressing recombinant RER1 (tagged with epitopes like C-Myc/DDK) are lysed under conditions that preserve protein-protein interactions, followed by immunoprecipitation with antibodies against RER1 or its interaction partners. Proximity ligation assays (PLA) can provide additional validation of interactions in a cellular context with spatial resolution.

Immunofluorescence assays (IFA) are valuable for studying the co-localization of RER1 with potential interaction partners. This approach has successfully demonstrated that wild-type RER1 co-localizes with the cis-Golgi marker GM130, while the RER1Δ25 mutant shows only partial co-localization . When designing such experiments, it's important to include appropriate markers for subcellular compartments (e.g., GM130 for cis-Golgi, KDEL for ER) . For more dynamic analyses, live-cell imaging with fluorescently tagged RER1 and potential interaction partners can provide insights into trafficking and interaction kinetics. Finally, fractionation of cell lysates into detergent-soluble and insoluble fractions can help determine if RER1 affects the solubility state of interaction partners, as demonstrated by its effect on Triton X-100 soluble and insoluble fractions of αSyn .

How can functional assays be designed to evaluate recombinant RER1 activity?

Designing functional assays for recombinant RER1 requires focusing on its primary role in protein trafficking and quality control. One effective approach is to measure RER1's ability to modulate levels of known substrate proteins. For example, co-expression experiments with αSyn have demonstrated that RER1 significantly reduces both soluble and insoluble αSyn levels, providing a quantifiable readout of RER1 function . This can be assessed through western blotting and quantitative image analysis. The specificity of this effect can be verified by testing RER1's impact on related proteins like βSyn, which lacks the NAC domain and is not affected by RER1 overexpression .

Another functional assay could examine RER1's impact on γ-secretase activity, as RER1 has been shown to be required for proper cell surface expression and activity of the γ-secretase complex . This could involve measuring γ-secretase substrate cleavage in the presence of varying levels of recombinant RER1. Additionally, trafficking assays that monitor the movement of cargo proteins between the ER and Golgi can provide insights into RER1's retrieval function. Such assays might employ fluorescently tagged cargo proteins combined with live-cell imaging or biochemical approaches like endoglycosidase H sensitivity assays, which can distinguish between ER and Golgi-modified glycoproteins.

What statistical approaches are recommended for analyzing RER1 experimental data?

Multivariate statistical methods are recommended for analyzing complex experimental data related to RER1 function and activity. Unlike traditional univariate methods that evaluate responses by changing one variable at a time, multivariate approaches allow researchers to account for interactions between variables, characterize experimental error, and gather high-quality information with fewer experiments . This is particularly valuable when optimizing conditions for recombinant RER1 expression or functional assays where multiple factors may influence outcomes.

For experimental design optimization, design of experiment (DoE) methodologies can systematically evaluate multiple variables simultaneously . This might include factorial designs or response surface methodology to identify optimal conditions for RER1 expression or activity. When analyzing RER1's effects on target proteins (such as αSyn or γ-secretase components), appropriate statistical tests for comparing means (t-tests, ANOVA) should be employed, with corrections for multiple comparisons when necessary. Regression analyses can help establish dose-response relationships between RER1 expression levels and functional outcomes. For image-based co-localization studies, quantitative co-localization coefficients (Pearson's, Mander's) provide more objective measures than visual assessment alone. Finally, when interpreting results, it's important to distinguish between statistical significance and biological relevance, especially when dealing with overexpression systems that may not reflect physiological conditions.

What are common pitfalls in recombinant RER1 research and how can they be addressed?

Several challenges can arise when working with recombinant RER1, and understanding these pitfalls is crucial for successful experiments. One common issue is protein aggregation or misfolding during expression, which can be addressed by optimizing expression conditions through multivariate experimental design approaches . For membrane proteins like RER1, solubilization and maintenance of proper folding during purification are particularly challenging. This may require screening different detergents or considering native membrane-mimicking systems like nanodiscs or liposomes for functional studies.

Another potential pitfall is the presence of the epitope tag interfering with RER1 function. The positioning of tags should be carefully considered, as C-terminal modifications could potentially disrupt the critical C-terminal 25 amino acids required for proper RER1 localization . Control experiments comparing tagged and untagged versions can help assess any functional impact of the tag. When studying RER1's effect on protein levels, distinguishing between effects on synthesis, degradation, or trafficking requires careful experimental design, potentially including pulse-chase experiments or specific inhibitors of different pathways.

Antibody specificity is another concern, particularly when studying endogenous RER1 or when using antibodies across species. Validation using RER1-deficient cells as negative controls is advisable . Finally, overexpression artifacts can complicate interpretation of results. Complementary approaches using RER1 knockdown/knockout alongside overexpression studies can provide more balanced insights into physiological functions.

What emerging technologies might advance our understanding of RER1 function?

Emerging technologies offer exciting possibilities for deepening our understanding of RER1 function. CRISPR/Cas9 gene editing, which has been successfully used to generate Rer1-deficient HAP1 cells , provides opportunities for precise manipulation of RER1 in various cellular models, including the introduction of specific mutations or tagging of the endogenous protein. This approach can help overcome limitations of overexpression studies and provide insights into physiological functions. Cryo-electron microscopy (cryo-EM) holds promise for elucidating the structure of RER1 in complex with its binding partners or within membrane environments, potentially revealing the molecular basis of substrate recognition and trafficking.

Advanced live-cell imaging techniques, including super-resolution microscopy and single-particle tracking, could visualize RER1-mediated trafficking events with unprecedented spatial and temporal resolution. Proximity-based labeling approaches like BioID or APEX2 can identify the proximal proteome of RER1 in different cellular compartments, potentially discovering novel interaction partners. Lastly, systems biology approaches integrating proteomics, transcriptomics, and functional genomics could help position RER1 within broader cellular networks and reveal unexpected connections to disease pathways or cellular processes. These technologies, applied to bovine RER1, could uncover species-specific functions and provide comparative insights into the evolution of this important protein.

How might recombinant bovine RER1 research contribute to understanding neurodegenerative diseases?

Research on recombinant bovine RER1 has significant potential to contribute to our understanding of neurodegenerative diseases through several mechanisms. RER1 has been shown to significantly decrease levels of both wild-type and disease-causing mutants of α-synuclein (A30P, A53T, and E46K), which are implicated in Parkinson's disease and other synucleinopathies . Furthermore, RER1 co-localizes with α-synuclein-positive Lewy bodies in human diseased brain tissues . These findings suggest that RER1 might be a novel and potentially important mediator of α-synuclein levels and could represent a therapeutic target for diseases characterized by α-synuclein accumulation.

Additionally, RER1's role in regulating γ-secretase complex formation and activity links it to pathways relevant to Alzheimer's disease, as γ-secretase processes amyloid precursor protein (APP) and generates amyloid-β peptides . RER1 has been shown to negatively regulate amyloid-β peptide levels, suggesting another potential neuroprotective mechanism . Comparative studies between bovine and human RER1 could reveal species-specific differences in these neuroprotective functions, potentially identifying structural or functional elements that might be exploited for therapeutic development. Moreover, understanding how RER1 interacts with the ubiquitin-proteasome system and NEDD4 could provide insights into protein quality control mechanisms that are often compromised in neurodegenerative diseases . This research direction represents an important intersection between fundamental protein trafficking mechanisms and disease-relevant processes.

Research AreaRecombinant RER1 ApplicationPotential Impact on Neurodegenerative Research
α-Synuclein PathologyModulation of α-synuclein levelsNovel therapeutic approaches for Parkinson's disease
γ-Secretase RegulationControl of Aβ peptide productionPotential intervention in Alzheimer's disease progression
Protein Quality ControlInteraction with ubiquitin-proteasome systemUnderstanding proteostasis failure in neurodegeneration
ER-Golgi TraffickingRetention of disease-associated proteinsPrevention of toxic protein aggregation
Notch SignalingModulation through γ-secretase regulationImpact on neural stem cell maintenance and neurogenesis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.