Recombinant Bovine Protein shisa-2 homolog (SHISA2)

Shipped with Ice Packs
In Stock

Description

Myogenesis Regulation

  • Muscle progenitor fusion: SHISA2 promotes myoblast fusion by modulating Rac1/Cdc42-mediated cytoskeletal remodeling. Knockdown inhibits fusion, while overexpression accelerates myotube formation .

  • Notch signaling interplay: Repressed by Notch1 intracellular domain (N1ICD), with expression inversely correlated to Notch activity in satellite cells .

Cancer Progression

  • Prostate cancer (PC): Overexpressed in high-grade PC (Gleason 8–10). SHISA2 knockdown reduces cell viability by 60–70%, while overexpression enhances proliferation via WNT5A upregulation .

  • Mechanism: Regulates Wnt5a synthesis and secretion, activating Wnt signaling pathways linked to tumor aggressiveness .

Neuronal Guidance

  • Axon pathfinding: SHISA2 inhibits Frizzled3 glycosylation, retaining it in the ER and suppressing Wnt/planar cell polarity (PCP) signaling. Shisa2 knockdown causes premature axon turning in spinal commissural neurons .

Key Research Findings

Study FocusModel SystemOutcome
Myoblast fusionC2C12 cellsSHISA2 overexpression reduces Ki67+ proliferating cells by 80% and induces premature fusion
Prostate cancerPC-3 cellsSHISA2 knockdown decreases WNT5A levels by 50%, impairing cell migration
Neuronal guidanceRat spinal cordSHISA2 overexpression randomizes anterior-posterior axon guidance (54% vs. 86% in controls)

Research Implications

SHISA2 serves as both a biomarker and therapeutic target in oncology and regenerative medicine. Its dual role in Wnt signaling modulation (inhibiting Frizzled3 in neurons vs. activating WNT5A in cancer) highlights context-dependent functionality. Current studies focus on isoform-specific inhibitors and ER-targeted delivery systems to exploit its regulatory mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in your order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery times may vary depending on your location and the purchasing method. We recommend contacting your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form maintains stability for 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SHISA2; TMEM46; Protein shisa-2 homolog; Transmembrane protein 46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-289
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
SHISA2
Target Protein Sequence
SGEYCHGWLDAQGVWRIGFQCPERFDGGDATICCGSCALRYCCSSADARLDQGGCDNDRQQGAGEPGRADKDGPDGSAVPIYVPFLIVGSVFVAFIVLGSLVAACCCRCLRPKQEPQLSRAPGGPRLVETIPMIPSASTSRGSSSRQSSTAASSSSSANSGARAPPTRSQTNCCLPEGTMNNVYVNMPTNFSVLNCQQATQIVPHQGQYLHPPFVGYTVQPDSVPLTPVPPFLDGLQTGYRQLQAPFPHTNSEQKMYPAVTV
Uniprot No.

Target Background

Function
SHISA2 plays a crucial role in the maturation of presomitic mesoderm cells by individually attenuating both FGF and WNT signaling.
Database Links
Protein Families
Shisa family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What is the primary mechanism of action for SHISA2 protein?

SHISA2 functions through three primary mechanisms: (1) Receptor Retention - binding to immature forms of Frizzled (Fz) Wnt receptors and FGF receptors in the endoplasmic reticulum, preventing their glycosylation and cell-surface expression; (2) Dual Signaling Inhibition - cell-autonomously suppressing both Wnt/β-catenin and FGF/MAPK pathways to modulate morphogenetic gradients critical for embryonic patterning; and (3) Post-Translational Regulation - interacting with receptors in the ER, retaining them in a pre-mature state and reducing ligand responsiveness. These mechanisms collectively enable SHISA2 to establish signaling gradients by spatially restricting receptor availability, ensuring proper anterior-posterior patterning during development.

How is SHISA2 localized within the cell?

SHISA2 is primarily localized to the endoplasmic reticulum. This has been confirmed through co-localization studies using ER-Tracker vital dye in C2C12 cells transfected with EGFP-Shisa2 fusion protein . The ER localization is consistent with its function in regulating receptor maturation by interacting with immature forms of receptors before they reach the cell surface. Researchers investigating SHISA2 localization should consider fluorescent protein tagging approaches with appropriate ER markers for validation.

What are the known signaling pathways modulated by SHISA2?

SHISA2 has been demonstrated to modulate several key signaling pathways:

PathwayMechanism of SHISA2 RegulationBiological Context
Wnt/β-cateninPrevents cell surface expression of Frizzled receptorsEmbryonic patterning, somitogenesis
FGF/MAPKRetains immature FGF receptors in ERPresomitic mesoderm maturation
NotchExpression inversely correlated with Notch activitySatellite cell activation, myogenesis
Rac1/Cdc42Required for SHISA2-mediated cytoskeletal remodelingMyoblast fusion

This pathway interaction profile highlights SHISA2's role as a critical node in developmental and regenerative processes .

What role does SHISA2 play in somitogenesis?

In Xenopus, SHISA2 is essential for somitogenesis, the process of segmental tissue formation. It functions in PSM (presomitic mesoderm) maturation by ensuring timely maturation of somitic precursors through attenuation of FGF and Wnt signals. SHISA2 knockdown studies have demonstrated delayed PSM maturation, resulting in reduced somite count and disrupted segmental boundaries. SHISA2 establishes morphogenetic gradients by spatially restricting receptor availability, which is crucial for proper anterior-posterior patterning. Researchers studying embryonic development should note that SHISA2 exhibits dynamic expression in the PSM, somites, and neural tissues during Xenopus embryogenesis, with gradients critical for segmental clock regulation.

How can I design effective SHISA2 loss-of-function studies in developmental models?

For effective SHISA2 loss-of-function studies, researchers should consider multiple complementary approaches:

  • RNA interference: Design specific shRNAs targeting SHISA2. Previously validated constructs include SHISA2-si1 and SHISA2-si2 . Select stable transfection for sustained knockdown effects.

  • CRISPR/Cas9 gene editing: Target early exons to ensure complete loss of function.

  • Morpholino antisense oligonucleotides: Especially useful in Xenopus models for developmental studies.

  • Rescue experiments: Include parallel studies with recombinant SHISA2 to demonstrate specificity of observed phenotypes.

For phenotypic analysis, focus on:

  • Quantitative assessment of somite number and boundary formation

  • Marker gene expression analysis for PSM maturation

  • Signaling pathway activity measurements (Wnt/β-catenin, FGF/MAPK)

  • Time-lapse imaging to capture dynamic aspects of segmentation .

How does SHISA2 regulate myoblast fusion?

SHISA2 plays a critical role in regulating myoblast fusion through multiple mechanisms. Knockdown of SHISA2 inhibits the fusion of myoblasts without affecting their proliferation, while overexpression in proliferating myoblasts inhibits proliferation but promotes premature fusion . At the molecular level, Rac1/Cdc42-mediated cytoskeletal F-actin remodeling is required for SHISA2 to promote myoblast fusion. Interestingly, SHISA2-overexpressing nascent myotubes actively recruit myoblasts to fuse with them, suggesting SHISA2 may influence both the fusion-competence of myoblasts and the fusion-receptivity of myotubes .

What is the relationship between SHISA2 expression and satellite cell activation?

SHISA2 expression is strongly correlated with satellite cell activation status. Expression analysis shows that SHISA2 mRNA levels are approximately 12 times higher in activated satellite cells compared to quiescent satellite cells . Furthermore, SHISA2 expression is inversely correlated with Notch signaling activation, which is known to maintain satellite cell quiescence. During myogenic differentiation, SHISA2 mRNA levels rapidly increase in a pattern similar to myogenin expression, an established marker of early myogenic differentiation . These expression patterns suggest SHISA2 may function as a molecular switch during the transition from quiescence to activation and subsequently to differentiation in muscle progenitor cells.

What experimental approaches can be used to study SHISA2 in myoblast fusion?

For studying SHISA2 in myoblast fusion, researchers should consider these methodological approaches:

  • Co-culture fusion assays: Use differentially labeled cell populations (e.g., GFP and TdTomato) to distinguish between fusion partners. This approach can determine whether SHISA2 affects the fusion competence of myoblasts, the receptivity of nascent myotubes, or both .

  • Time-lapse microscopy: Monitor fusion events in real-time following SHISA2 manipulation.

  • Cytoskeletal analysis: Examine F-actin reorganization using phalloidin staining and confocal microscopy.

  • Molecular pathway interrogation: Investigate Rac1/Cdc42 activity using pull-down assays for GTP-bound forms.

  • Fusion index quantification: Calculate the percentage of nuclei in multinucleated myotubes versus mononuclear myoblasts under different experimental conditions .

What is the evidence linking SHISA2 to cancer progression?

SHISA2 overexpression has been identified in clinical high-grade prostate cancer (PC) with Gleason scores between 8 and 10 . Functional studies indicate that SHISA2 is positively involved in cell proliferation and the progression of high-grade PC. The correlation between SHISA2 expression levels and Gleason scores suggests that SHISA2 may serve as a potential biomarker for aggressive prostate cancer . This contrasts with SHISA2's role in normal myoblasts, where overexpression inhibits proliferation , suggesting context-dependent functions that warrant further investigation in different cancer types and cellular environments.

How can SHISA2 expression be accurately assessed in tumor samples?

For accurate assessment of SHISA2 expression in tumor samples, researchers should employ multiple complementary techniques:

  • Immunohistochemistry: Use purified anti-SHISA2 antibodies with appropriate controls. Staining should be scored based on intensity (negative, weak, moderate, or strong) and evaluated by clinical pathologists in a blinded manner .

  • Quantitative RT-PCR: Measure SHISA2 mRNA levels using validated primers.

  • Western blot analysis: Assess protein expression levels.

  • In situ hybridization: Visualize expression patterns within the tissue architecture.

  • Comparative analysis: Group samples by clinical parameters (e.g., Gleason scores for prostate cancer) to establish correlations between SHISA2 expression and disease progression .

What are the challenges in targeting SHISA2 for cancer therapeutics?

Developing therapeutic approaches targeting SHISA2 presents several challenges:

  • Subcellular localization: As an ER-resident protein, SHISA2 may be difficult to target with conventional antibody-based approaches that cannot penetrate cellular membranes.

  • Context-dependent functions: SHISA2 exhibits opposing effects on proliferation in different contexts, promoting proliferation in prostate cancer cells while inhibiting it in myoblasts .

  • Pathway redundancy: SHISA2 modulates multiple signaling pathways, and compensatory mechanisms may arise if only SHISA2 is targeted.

  • Model systems: Developing appropriate in vitro and in vivo models that accurately recapitulate SHISA2's role in human tumors.

  • Biomarker validation: Further studies are needed to validate SHISA2 as a diagnostic or prognostic biomarker across larger patient cohorts with diverse cancer types.

What are the recommended approaches for generating recombinant SHISA2 protein?

For generating recombinant SHISA2 protein, researchers should consider the following approaches:

  • Expression vector construction: Amplify full-length SHISA2 cDNA using RT-PCR from appropriate source tissue. For bovine SHISA2, reference sequences are available in databases (KEGG: bta:617336; STRING: 9913.ENSBTAP00000024243; UniGene: Bt.22389). Consider adding epitope tags (e.g., HA-tag, His-tag) to facilitate purification and detection .

  • Expression systems: Mammalian expression systems are preferred for proper post-translational modifications and folding of this ER-resident protein. HEK293 cells have been successfully used for SHISA2 expression .

  • Purification strategy: Include appropriate signal sequences and purification tags. Consider using specialized approaches for membrane-associated proteins.

  • Validation methods: Confirm protein identity by mass spectrometry and activity through functional assays targeting known SHISA2-regulated pathways (Wnt, FGF).

  • Quality control: Assess lot-to-lot consistency through bioactivity assays, similar to approaches used for other recombinant proteins .

What cell-based assays are most informative for studying SHISA2 function?

Several cell-based assays have proven particularly informative for studying SHISA2 function:

  • Fusion assays: Co-culture of differentially labeled myoblasts (e.g., TdTomato and GFP) to quantify fusion events and dissect the role of SHISA2 in either fusion-competent myoblasts or nascent myotubes .

  • Proliferation assays: Cell Counting Kit-8 assays have been used to measure proliferation changes following SHISA2 manipulation .

  • Colony formation assays: Cells transfected with SHISA2 or control vectors can be cultured in selective medium, fixed with methanol, and stained with crystal violet to assess clonogenic potential .

  • Reporter assays: Luciferase reporters for Wnt/β-catenin and FGF/MAPK pathways can measure SHISA2's inhibitory effects on these signaling cascades.

  • Immunofluorescence: Visualization of receptor localization (ER retention vs. surface expression) using confocal microscopy .

How can I design effective gain-of-function studies for SHISA2?

For effective gain-of-function studies of SHISA2:

  • Vector selection: Both plasmid-based (pIRESneo3) and viral (adenovirus) vectors have been successfully used for SHISA2 overexpression .

  • Expression verification: Confirm overexpression using RT-qPCR, western blot, and immunofluorescence.

  • Inducible systems: Consider doxycycline-inducible expression systems for temporal control.

  • Delivery methods:

    • Transient transfection using Lipofectamine or FuGENE6 for short-term studies

    • Electroporation using the Neon Transfection System for hard-to-transfect cells

    • Viral transduction (adenovirus achieves 80-90% efficiency) for higher efficiency

  • Fusion protein strategies: EGFP-SHISA2 fusion proteins allow visualization of subcellular localization while maintaining functional activity .

  • Control selection: Empty vectors and GFP-only vectors serve as appropriate controls for plasmid and viral approaches, respectively .

How does SHISA2 coordinate with other regulatory proteins in developmental signaling networks?

Understanding SHISA2's role within larger developmental signaling networks remains a significant research challenge. SHISA2 simultaneously modulates multiple pathways (Wnt, FGF) that interact in complex ways during development. Future research should investigate:

  • Temporal dynamics: How SHISA2 expression changes throughout developmental processes and whether these changes correlate with critical developmental transitions.

  • Spatial regulation: Whether SHISA2 activity creates localized signaling environments within developing tissues.

  • Interaction partners: Identification of SHISA2-interacting proteins beyond the currently known receptors using methods such as proximity labeling or co-immunoprecipitation coupled with mass spectrometry.

  • Pathway crosstalk: How SHISA2-mediated inhibition of one pathway affects the activity of others, particularly in contexts where multiple pathways regulate the same developmental process.

What are the comparative differences in SHISA2 function across species?

While SHISA2 functions have been studied in various model organisms, direct comparative analyses across species remain limited. Researchers should consider:

  • Sequence conservation analysis: Align SHISA2 sequences across vertebrates to identify conserved domains that might indicate functional significance.

  • Cross-species functional complementation: Test whether SHISA2 from one species can rescue loss-of-function phenotypes in another.

  • Expression pattern comparison: Determine whether SHISA2 expression domains are conserved across species during development.

  • Pathway sensitivity: Investigate whether SHISA2 has evolved differential sensitivity to various signaling pathways across species.

  • Bovine-specific studies: Given the conservation across vertebrates, bovine SHISA2 likely plays analogous roles in embryonic development (somite formation, axial elongation) and muscle biology (satellite cell-mediated muscle growth and repair).

How might single-cell approaches enhance our understanding of SHISA2 biology?

Single-cell technologies offer unprecedented opportunities to advance SHISA2 research:

  • scRNA-seq: Map SHISA2 expression across heterogeneous cell populations during development or in disease states to identify cell types where SHISA2 may play critical roles.

  • Single-cell proteomics: Profile SHISA2 protein levels alongside pathway components to understand correlation between SHISA2 expression and pathway activity at single-cell resolution.

  • Spatial transcriptomics: Preserve spatial information while examining SHISA2 expression patterns in tissues to identify potential morphogenetic gradients.

  • Live-cell imaging: Track SHISA2-GFP fusion proteins in individual cells to capture dynamic changes in localization and concentration during differentiation or fusion events.

  • Clonal analysis: Study the effects of SHISA2 manipulation in individual clones within a heterogeneous population to understand cell-autonomous versus non-cell-autonomous effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.