Recombinant Bovine Protein SYS1 homolog (SYS1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
SYS1; Protein SYS1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SYS1
Target Protein Sequence
MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVHSSPSLDQVFDAEILGFST PPGRLSTMSFVLNALTCALGLLYFIRRGKQCLDFTVTVHFFHLLGCWLYSSRFPSALTWW LVQAVCIALMAVIGEYLCMRSELKEIPLNSAPKSSV
Uniprot No.

Target Background

Function

Function: Involved in protein trafficking and may function as a receptor for ARFRP1.

Database Links
Protein Families
SYS1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the SYS1 homolog protein and what are its known functions?

The SYS1 homolog protein belongs to a family of conserved proteins found across multiple species, including yeast, nematodes, and mammals. In organisms like C. elegans, SYS-1 functions as a β-catenin-like protein involved in asymmetric cell division and cell fate determination . SYS-1 interacts with POP-1/TCF transcription factors to regulate gene expression during development. The protein shows asymmetric distribution in daughter cells following division, with higher concentrations in distal daughter cells compared to proximal daughter cells, as demonstrated by fluorescent reporter studies . This asymmetry is critical for proper developmental patterning and transcriptional activation of target genes like ceh-22b. In yeast and potentially in bovine cells, SYS1 homologs may function in intracellular protein trafficking and secretion pathways, although the specific mechanisms differ between species.

How is SYS1 homolog protein expression regulated at the cellular level?

SYS1 homolog protein expression appears to be regulated primarily at the post-translational level rather than through transcriptional or translational mechanisms. Research using reporter constructs in C. elegans has demonstrated that while SYS-1 mRNA is expressed uniformly, the protein shows dramatic asymmetric distribution . When nonsense codons were introduced into the SYS-1 coding sequence (creating VNS::SYS-1(stops)), the reporter showed uniform expression in both daughter cells after division, indicating that the asymmetry results from differential protein stability rather than differential transcription or translation . This post-translational regulation involves the Wnt signaling pathway components, particularly frizzled and dishevelled homologs. When these components are disrupted through mutation or RNA interference, the normal asymmetric distribution of SYS-1 protein is compromised, with lower levels observed in both daughter cells rather than the normal high-distal/low-proximal pattern .

What experimental systems are commonly used to study SYS1 homolog proteins?

Several experimental systems have proven valuable for studying SYS1 homolog proteins, each with distinct advantages. The nematode C. elegans provides an excellent model for studying SYS-1's role in development and cell fate determination, as its transparent body and invariant cell lineage allow for direct visualization of protein dynamics during cell division . Researchers have generated fluorescent protein fusions (such as VNS::SYS-1) that permit real-time tracking of SYS-1 localization and abundance. The yeast Pichia pastoris serves as a useful platform for studying SYS1 homolog function in secretory pathways and for recombinant protein production . In P. pastoris, deletion of the los1 homolog (which may interact with trafficking pathways involving SYS1) has been shown to increase production of recombinant proteins, suggesting functional connections between these cellular components . For bovine SYS1 specifically, mammalian cell culture systems like HEK293 or CHO cells may be employed for recombinant expression, though specific methodologies must be adapted from existing protocols for optimal results.

How does the asymmetric distribution of SYS1 homolog proteins contribute to cell fate determination?

The asymmetric distribution of SYS1 homolog proteins plays a critical role in determining cell fates during development, particularly through its relationship with transcription factors like POP-1/TCF. Research in C. elegans has revealed that SYS-1 asymmetry is reciprocal to POP-1 asymmetry, creating a precise ratio of these proteins that determines transcriptional outcomes . Following an asymmetric cell division, the distal daughter cell contains high levels of SYS-1 and low levels of POP-1, while the proximal daughter shows the opposite pattern. This ratio is crucial for activating specific developmental gene programs: quantitative analysis showed SYS-1 levels approximately 25-fold higher in distal daughters compared to proximal sisters . The SYS-1:POP-1 ratio directly influences transcriptional activation, with higher ratios promoting the expression of target genes like ceh-22b. This mechanism provides an elegant method for rapidly and robustly adjusting gene expression profiles in daughter cells following division. Disruption of this asymmetry through mutations in regulatory components such as frizzled or dishevelled homologs leads to abnormal cell fate specification and developmental defects, confirming the functional importance of this distribution pattern .

What are the molecular mechanisms regulating SYS1 protein stability and asymmetric distribution?

The molecular mechanisms governing SYS1 protein stability and asymmetric distribution involve a complex interplay between Wnt signaling components and protein degradation pathways. Evidence from C. elegans research indicates that frizzled (LIN-17, MOM-5) and dishevelled (DSH-2, MIG-5) homologs are essential regulators of SYS-1 asymmetry . These components appear to function in a forked pathway that simultaneously promotes SYS-1 accumulation in distal daughter cells while facilitating POP-1 reduction. Interestingly, dishevelled homologs may play dual roles, promoting SYS-1 accumulation in distal daughters while potentially enhancing SYS-1 degradation in proximal daughters . When dishevelled function is compromised through mutation (e.g., in dsh-2 mutants), SYS-1 levels become detectable in both daughter cells, though at reduced levels compared to wild-type distal cells . This suggests that post-translational regulation of SYS-1 involves both stabilization and destabilization mechanisms mediated through the same signaling pathway. The precise molecular details of how these components interact with the protein degradation machinery remain areas of active investigation. Potential mechanisms include differential ubiquitination, proteasomal targeting, or sequestration into distinct subcellular compartments that affect protein turnover rates.

What experimental designs are most appropriate for studying SYS1 homolog function across different model systems?

Selecting appropriate experimental designs for studying SYS1 homolog function requires careful consideration of the research question, model system, and specific protein characteristics. For investigating SYS1's role in asymmetric cell division and development, longitudinal observational studies using fluorescent reporters in transparent organisms like C. elegans offer powerful approaches . These designs should incorporate time-lapse imaging to capture dynamic protein distribution patterns during and after cell division. Quantitative measurements of relative protein abundance in daughter cells are essential, as demonstrated by studies using ImageJ software to calculate the 25-fold difference in SYS-1 levels between distal and proximal daughters . For studying SYS1's impact on recombinant protein production, quasi-experimental designs with controlled comparison groups are most appropriate . These should include the wild-type strain and the gene-disruption variant grown under identical conditions, with multiple sampling timepoints (e.g., 12, 24, 48, 72, 96, 120, 144, and 168 hours post-induction) to capture the full expression profile . Protein quantification through densitometry analysis of SDS-PAGE gels provides a reliable outcome measure. Western blot validation using appropriate antibodies (e.g., anti-6×His for tagged proteins) offers necessary confirmation of target protein identity .

What are the optimal methods for genetically modifying SYS1 homologs in different host systems?

The optimal methods for genetically modifying SYS1 homologs vary according to the host system, with each approach offering distinct advantages and limitations. For yeast systems like Pichia pastoris, homologous recombination represents the most efficient approach, as demonstrated in los1 homolog disruption studies . This method involves creating a disruption cassette containing a selectable marker (e.g., KanMX) flanked by 1000-bp upstream and downstream regions of the target gene . Validation of successful modification requires multiple confirmatory PCR reactions using primers that span the integration junctions. For mammalian cell systems expressing bovine SYS1, CRISPR-Cas9 genome editing offers precise modification capabilities. This approach requires careful design of guide RNAs targeting specific SYS1 sequences, along with appropriate donor templates for knock-in applications. For transient expression studies, plasmid-based systems with inducible promoters provide controllable expression of wild-type or mutant SYS1 variants. When studying SYS1 in the context of protein trafficking, fluorescent fusion proteins enable real-time visualization of localization patterns, though care must be taken to ensure that tags do not interfere with native protein function. For all modification approaches, comprehensive validation through sequencing, protein expression analysis, and functional assays is essential to confirm the intended genetic changes and their phenotypic consequences.

What analytical techniques best capture the dynamic behavior of SYS1 homolog proteins during cell division?

Capturing the dynamic behavior of SYS1 homolog proteins during cell division requires sophisticated analytical techniques that combine high-resolution imaging with quantitative analysis. Live-cell confocal microscopy using photoactivatable fluorescent protein fusions (like VNS::SYS-1) provides the temporal and spatial resolution necessary to track SYS1 movements throughout the cell cycle . Time-lapse imaging sequences should be acquired at intervals of 1-2 minutes to capture rapid changes in protein localization, such as the punctate centrosomal accumulation observed during mitosis in C. elegans SGP divisions . Image analysis should employ ratiometric measurements to quantify relative protein levels between daughter cells, normalizing against background fluorescence in adjacent non-relevant tissues as control . Fluorescence recovery after photobleaching (FRAP) experiments can provide insights into protein mobility and turnover rates in different cellular compartments. For biochemical analysis of asymmetric distribution mechanisms, cell sorting of recently divided daughter cells followed by immunoprecipitation and mass spectrometry can identify interacting partners that may regulate stability. Correlative light and electron microscopy (CLEM) offers another powerful approach, enabling visualization of SYS1 in the context of ultrastructural features like centrosomes or Golgi apparatus. These techniques should be complemented by genetic perturbations (e.g., frizzled or dishevelled mutants) to establish causal relationships between regulatory pathways and observed SYS1 dynamics .

How can researchers effectively compare experimental results across different SYS1 homolog studies?

Effectively comparing results across different SYS1 homolog studies requires systematic approaches that account for methodological variations and biological context differences. Researchers should first establish homology relationships between SYS1 proteins from different species through comprehensive sequence alignment and phylogenetic analysis. This clarifies which functional domains are conserved and may therefore share similar mechanisms. When comparing protein expression data, normalization procedures must account for different detection methods—for example, densitometry measurements from SDS-PAGE gels versus fluorescence intensity from reporter constructs . Statistical meta-analysis techniques can help integrate findings across multiple studies while accounting for sample size variations and methodological differences. For functional comparisons, standardized phenotypic assays should be employed where possible. For instance, when examining effects on recombinant protein production, metrics such as fold-change relative to wild-type controls provide more comparable measures than absolute concentration values . When assessing asymmetric distribution patterns, quantitative measures like the ratio between daughters (e.g., the 25-fold difference observed in C. elegans) offer standardized comparisons across studies . Additionally, researchers should carefully document experimental conditions including temperature, media composition, cell cycle stage, and detection thresholds, as these factors can significantly influence SYS1 behavior and experimental outcomes.

How should researchers interpret contradictory findings about SYS1 homolog function across different species?

Interpreting contradictory findings about SYS1 homolog function across different species requires careful consideration of evolutionary divergence, cellular context, and methodological differences. Researchers should first determine whether the contradictions stem from genuine biological differences or methodological variations. SYS1 homologs may have evolved distinct functions in different lineages while maintaining some core activities. In C. elegans, SYS-1 functions primarily in asymmetric cell division and transcriptional regulation through β-catenin-like activity , while in yeast, SYS1-related pathways appear more involved in protein trafficking and secretion . These functional differences may reflect adaptation to the distinct cellular architecture and developmental requirements of these organisms. When analyzing contradictory results, researchers should examine the experimental approaches in detail, focusing on how SYS1 function was assessed (e.g., through loss-of-function, overexpression, or reporter studies). Differences in cellular context are particularly important—for instance, the role of SYS1 in protein production might be more pronounced in specialized secretory cells than in other cell types. Creating comparative tables that systematically document SYS1 functions, experimental approaches, and cellular contexts across species can help identify patterns that explain apparent contradictions. Additionally, computational approaches such as protein-protein interaction network analysis can reveal how SYS1 may participate in different cellular pathways depending on the available interaction partners in each species.

What statistical approaches are most appropriate for analyzing SYS1 protein distribution data?

Statistical analysis of SYS1 protein distribution data requires approaches that can account for both spatial patterns and quantitative differences in protein levels. For analyzing asymmetric distribution between daughter cells, paired statistical tests are most appropriate since the cells derived from the same division represent naturally paired samples. When quantifying fluorescence intensities, normalization to background signals is essential, as demonstrated in C. elegans studies where SYS-1 signal in each SGP daughter was normalized to background fluorescence in germ cells . Due to the often non-normal distribution of protein intensity data, non-parametric tests like the Wilcoxon signed-rank test may be more appropriate than parametric alternatives. For time-course experiments examining protein expression over multiple timepoints (e.g., 12, 24, 48, 72, 96, 120, 144, and 168 hours), repeated measures ANOVA or mixed-effects models should be employed to account for the longitudinal nature of the data . When comparing multiple experimental conditions (e.g., wild-type vs. various mutants), post-hoc tests with appropriate corrections for multiple comparisons (such as Tukey's HSD or Bonferroni correction) are necessary to maintain statistical rigor. For spatial distribution patterns, quantitative image analysis techniques such as line-scan intensity profiles or radial distribution functions provide more detailed information than simple cell-to-cell comparisons. Finally, machine learning approaches like supervised classification algorithms can help identify subtle distribution patterns that might not be apparent through conventional statistical analysis.

How might manipulation of SYS1 homologs improve recombinant protein production systems?

Manipulation of SYS1 homologs and related trafficking proteins offers promising strategies for enhancing recombinant protein production systems across various expression platforms. The observed 1.85-fold increase in recombinant protein expression following los1 deletion in Pichia pastoris provides compelling evidence for this approach . This enhancement likely results from alterations in cellular trafficking pathways that normally regulate protein secretion. Similar strategies targeting SYS1 itself might produce comparable or even greater improvements in protein yield. Potential applications include engineering bovine cell lines with modified SYS1 expression for producing complex glycoproteins that require mammalian post-translational modifications. Researchers could implement inducible SYS1 knockout systems that maintain normal growth during the biomass accumulation phase but enhance protein secretion during the production phase. Another promising approach involves creating balanced co-expression systems where SYS1 levels are precisely tuned relative to the recombinant protein of interest, potentially alleviating secretory bottlenecks. For industrial-scale applications, stable cell lines with optimized SYS1 expression could significantly reduce production costs by increasing yield per culture volume. Future research should explore combinatorial approaches targeting multiple trafficking components simultaneously, as the protein secretion pathway involves numerous interacting factors beyond SYS1 alone. These strategies must be empirically tested for each recombinant protein of interest, as effects may vary depending on protein structure, size, and post-translational modification requirements.

What are the potential applications of SYS1 homolog research in understanding developmental disorders?

Research on SYS1 homologs holds significant potential for understanding developmental disorders, particularly those involving cell fate determination and tissue patterning. The critical role of SYS-1 in asymmetric cell division and transcriptional regulation through interaction with POP-1/TCF suggests that dysregulation of mammalian SYS1 homologs could contribute to developmental abnormalities . In C. elegans, disruption of the SYS-1:POP-1 ratio leads to cell fate specification defects, implying that similar mechanisms might underlie certain human developmental disorders . The Wnt signaling pathway, which regulates SYS-1 distribution, is well-established as critically important in human development, with mutations in this pathway associated with various congenital disorders and cancers. Studying how SYS1 interacts with the broader Wnt network could provide insights into conditions resulting from aberrant Wnt signaling. Additionally, the post-translational regulation of SYS1 through frizzled and dishevelled homologs points to potential therapeutic targets for modulating this pathway . Comparative studies across species could identify conserved regulatory mechanisms that might be compromised in human developmental disorders. Research in this area should progress from model organisms to human cell culture systems, examining whether human SYS1 homologs show similar asymmetric distribution patterns during stem cell divisions. Patient-derived induced pluripotent stem cells (iPSCs) from individuals with developmental disorders could be examined for abnormalities in SYS1 expression, localization, or function, potentially revealing previously unrecognized disease mechanisms.

What emerging technologies might advance our understanding of SYS1 homolog structure-function relationships?

Emerging technologies offer exciting opportunities to deepen our understanding of SYS1 homolog structure-function relationships at unprecedented resolution. Cryo-electron microscopy (cryo-EM) represents a powerful approach for determining the three-dimensional structure of SYS1 proteins, particularly in complex with interaction partners like transcription factors or trafficking components. This technique could reveal conformational changes associated with protein binding or post-translational modifications. Advanced protein modeling approaches using AlphaFold2 or similar AI-based prediction tools can generate highly accurate structural models of SYS1 homologs from different species, facilitating comparative structural analysis even in the absence of experimental structures. Proximity labeling techniques such as BioID or APEX2 can identify the spatial interactome of SYS1 in living cells, revealing transient or context-specific protein interactions that may escape detection by conventional immunoprecipitation approaches. Single-molecule tracking using techniques like stochastic optical reconstruction microscopy (STORM) could provide insights into the real-time dynamics of individual SYS1 molecules during cell division or trafficking events. CRISPR-based base editing and prime editing technologies offer precise approaches for introducing specific mutations into SYS1 genes, enabling systematic structure-function analysis through targeted modification of key residues. High-throughput functional assays coupled with deep mutational scanning could comprehensively map the relationship between SYS1 sequence variations and functional outcomes. Finally, organoid models derived from different tissues could provide physiologically relevant contexts for studying SYS1 function in complex three-dimensional environments that better recapitulate in vivo conditions than traditional cell culture systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.