Recombinant Bovine Protein tweety homolog 1 (TTYH1)

Shipped with Ice Packs
In Stock

Description

Biological Functions

TTYH1 is implicated in diverse physiological processes:

Key Roles

FunctionMechanismSupporting Evidence
Volume-Regulated Anion Channel (VRAC)Mediates chloride/osmolyte efflux during regulatory volume decrease (RVD) Calcium-independent activity
Neural Stem Cell (NSC) RegulationEnhances Notch signaling via γ-secretase activation, maintaining NSC stemness Interaction with Rer1
Extracellular Vesicle (EV) FormationInduces membrane curvature and EV biogenesis; co-localizes with Prominin-1 Tubulation observed in EVs

Research Applications

Recombinant Bovine TTYH1 is widely used in experimental models:

Experimental Uses

ApplicationDetailsReferences
Antibody ProductionPolyclonal antibodies (e.g., ab204046) validated for IHC, WB in humans
Protein Interaction StudiesBinds Rer1 to modulate γ-secretase activity
EV CharacterizationCo-purifies with Prom1 in sucrose gradients; forms tubulated EVs
Disease ModelingLinked to osteosarcoma migration deficits and NSC exhaustion in aging

Clinical Implications

TTYH1 dysregulation is associated with pathologies:

ConditionRole of TTYH1Findings
CancerPromotes migration/invasion in osteosarcoma cells (U2OS line) siRNA knockdown reduces metastasis
NeurodegenerationMaintains NSC quiescence; ablation accelerates age-related NSC loss NFATc3 pathway implicated
Retinal DiseaseInteracts with Prom1; mutations alter cholesterol binding in EVs CRRD-linked Prom1 mutants studied

Future Directions

Current gaps include structural resolution of bovine TTYH1 and its cholesterol-binding dynamics. Comparative studies with Prom1 could clarify shared mechanisms in EV biogenesis . Clinical trials targeting TTYH1 in cancers or neurodegenerative diseases remain unexplored.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
TTYH1; Protein tweety homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TTYH1
Target Protein Sequence
MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSAFAPQEREYQQALLLVAALAGLGLGLSLI FIAVYLIRFCCCRPPEPPGAKSPPPGGGCVTWNCIAALLVGCAGIGVGFYGNSETSDGVS QLSSALLHANHTLTAIDHLVLEMVERLNEAVRTELTTLEEVLTQRTELVAAARGARRQAE TVAQQLQGLAFWRGVPLSPLQVAEDVSFVEEYRWLAYVLLLLLELLVCLFTLLGLARQSK WLVIVMTVMSLLVLVLSWGSMGLEAATAVGLSDFCSSPDSYILNLTQEETGLGSDILNYY FLCNQAVSNPFQQRLTLSQRALANIHSQLQGLEREAVPQFPSAQKPVLSLEETLNVTEGN FHQLVALLHCRGLHKDYGSALRGLCEDTLEGLLFLLLFSLLSAGALATVLCSLPRAWALF PPSDDYEDTDDDDPFNPQESKRFVQWQSSI
Uniprot No.

Target Background

Function
Likely a chloride channel. It may play a role in cell adhesion.
Database Links

KEGG: bta:767943

STRING: 9913.ENSBTAP00000004515

UniGene: Bt.7619

Protein Families
Tweety family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of TTYH1?

TTYH1 (tweety homolog 1) is a member of the tweety family of proteins with a five-transmembrane topology and a minimal extracellular domain compared to related proteins like Prominin 1 . The protein functions primarily as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel . Three transcript variants encoding distinct isoforms have been identified for the TTYH1 gene . The protein is predominantly expressed in neural tissues and participates in membrane remodeling activities, particularly in the formation of extracellular vesicles (EVs) .

What are the main biochemical functions of TTYH1?

TTYH1 exhibits several key biochemical functions:

FunctionDescriptionRelated Proteins
Volume-sensitive chloride channel activityControls chloride ion flow in response to cell volume changesVarious chloride channels
Calcium ion bindingInteracts with calcium ions as part of its functionCAPNS1A, PCDHGB3, NOTCH3, CDH1
Iron ion transmembrane transporter activityMay participate in iron transport across membranesSLC40A1
Membrane bending/remodelingInduces formation of extracellular vesiclesProminin 1
Neural stem cell regulationMaintains quiescence of neural stem cellsVarious Notch pathway components

TTYH1 performs these functions either independently or in coordination with other proteins depending on the cellular context .

Which pathways is TTYH1 involved in?

TTYH1 participates in several important cellular pathways:

Pathway NameRelated ProteinsFunctional Significance
Ion channel transportTRPC4, TRPM1B, ANO6, CLCN5Regulation of ion homeostasis
Stimuli-sensing channelsSLC17A3, SRI, ANO8, TTYH2, CLCA1Response to environmental changes
Transmembrane transport of small moleculesABCE1, ATP2C2, SLC43A2B, PDZD11Cellular metabolism and signaling
Notch signaling pathwayRer1, γ-secretase complexNeural stem cell maintenance

Most notably, TTYH1 uniquely regulates the Notch signaling pathway by binding to and destabilizing Rer1 protein in the endoplasmic reticulum, which enhances γ-secretase activity and increases Notch intracellular domain (NICD) production .

How is TTYH1 expressed in different tissues?

TTYH1 expression is predominantly observed in neural tissues. In the mammalian brain, TTYH1 is highly expressed in neural stem cells (NSCs) and plays a crucial role in maintaining their quiescent state . Immunofluorescence studies using TTYH1 antibodies have shown expression in the ventricular zone (VZ) and subventricular zone (SVZ) of the developing brain, corresponding to areas with high neural stem cell activity . This expression pattern aligns with TTYH1's functions in neural development and stem cell regulation.

What are the optimal conditions for expressing recombinant bovine TTYH1?

  • Expression vector selection: Vectors with strong promoters (like T7) and fusion tags (His, GST, or Fc) can enhance expression and solubility .

  • Induction conditions: For bacterial expression, lower induction temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) often improve the solubility of membrane proteins like TTYH1.

  • Media optimization: Enriched media formulations with additional nutrients and osmolytes can enhance protein folding and stability.

  • Co-expression with chaperones: Co-expressing molecular chaperones like GroEL/GroES or trigger factor can improve the folding of complex membrane proteins .

For mammalian expression, transfection efficiency can be optimized using lipid-based transfection reagents or viral delivery systems, with expression typically performed at 37°C with 5% CO₂ for 48-72 hours post-transfection.

How can I improve the solubility of recombinant TTYH1?

Improving the solubility of recombinant TTYH1 can be challenging due to its transmembrane domains. Several approaches have proven effective:

  • Fusion tags: Adding solubility-enhancing tags such as SUMO, thioredoxin, or GST to the N-terminus can significantly improve solubility .

  • Detergent screening: For membrane proteins like TTYH1, systematic screening of detergents (e.g., CHAPS, DDM, Triton X-100) is crucial for solubilization during purification.

  • Buffer optimization: Including glycerol (5-10%), reducing agents, and specific salt concentrations can enhance stability and solubility.

  • Domain truncation: Expressing specific soluble domains rather than the full-length protein may improve yield and solubility.

  • Codon optimization: Adapting the TTYH1 coding sequence to the codon usage bias of the expression host can enhance translation efficiency and potentially improve folding .

A combination of these approaches is typically necessary to achieve optimal solubility for functional studies.

What purification strategies are most effective for TTYH1?

Effective purification of TTYH1 typically requires a multi-step approach:

  • Initial extraction: For membrane proteins like TTYH1, gentle detergent solubilization (using detergents like DDM or CHAPS) is critical to maintain structure and function.

  • Affinity chromatography: His-tag purification using immobilized metal affinity chromatography (IMAC) provides good initial purification . Alternative tags like GST or Fc can also be effective depending on the expression construct .

  • Size exclusion chromatography: This step helps separate TTYH1 from aggregates and improves homogeneity.

  • Ion exchange chromatography: As an additional polishing step, this can help remove contaminants with different charge properties.

  • Protein verification: Western blotting and mass spectrometry should be used to confirm protein identity and purity.

For functional studies, ensuring that TTYH1 maintains its native conformation is critical, which may require reconstitution into artificial lipid bilayers or nanodiscs for certain applications.

How does TTYH1 regulate neural stem cell properties?

TTYH1 plays a crucial role in maintaining neural stem cell (NSC) quiescence and regulating their differentiation through several mechanisms:

  • Notch signaling enhancement: TTYH1 uniquely enhances γ-secretase activity by binding to and destabilizing Rer1 protein in the endoplasmic reticulum . This results in increased production of Notch intracellular domain (NICD) and activation of Notch target genes, which maintains NSC stemness .

  • Stem cell niche regulation: In vivo experiments using Ttyh1 overexpression showed that a higher fraction of cells remained in the ventricular zone (VZ) and subventricular zone (SVZ), the embryonic neural stem cell regions, and expressed the neural stem cell marker Sox2 .

  • Proliferation control: Knockout of Ttyh1 in mice resulted in enhanced NSC proliferation and neurogenesis in adults, suggesting that TTYH1 normally acts as a brake on NSC activation and differentiation .

These findings indicate that TTYH1 is a critical regulator of the balance between NSC maintenance and differentiation during development and in adult neurogenesis.

What methods are most effective for studying TTYH1 function in neural stem cells?

Several complementary approaches have proven effective for studying TTYH1 function in neural stem cells:

  • Neurosphere assays: This in vitro technique allows assessment of NSC self-renewal and differentiation capacity. Studies show that TTYH1 expression levels affect neurosphere formation efficiency .

  • In utero electroporation: This technique allows for gene manipulation in embryonic brains. Overexpression or knockdown of TTYH1 via this method revealed its role in maintaining cells in the VZ/SVZ regions .

  • Conditional knockout models: Ttyh1 knockout mice have been used to study its function in vivo, revealing enhanced NSC proliferation and neurogenesis in adults .

  • BrdU incorporation assays: This technique labels dividing cells and has been used to demonstrate increased NSC proliferation in Ttyh1 knockout mice .

  • Immunofluorescence with cell-type markers: Using markers like GFAP/Sox2 (for type-B NSCs), EGFR (for transit-amplifying progenitors), and DCX (for neuroblasts) to track changes in cell populations after TTYH1 manipulation .

  • Behavioral tests: Morris water maze and open field tests have been used to assess the functional consequences of Ttyh1 knockout on learning, memory, and anxiety .

These methodologies provide a comprehensive toolkit for investigating TTYH1's role in neural development at molecular, cellular, and behavioral levels.

How can I assess the effect of TTYH1 mutations on neural development?

To evaluate the impact of TTYH1 mutations on neural development, researchers can employ several approaches:

  • Site-directed mutagenesis: Introduce specific mutations into TTYH1 expression constructs to assess their effects in in vitro and in vivo systems .

  • CRISPR/Cas9 genome editing: Generate precise mutations in the endogenous TTYH1 gene in cell lines or animal models. This approach was used to knock out exon 4 of the Ttyh1 gene to construct Ttyh1 KO mice .

  • Functional assays: Assess the impact of mutations on:

    • Chloride channel activity using patch-clamp electrophysiology

    • Membrane bending capacity through EV formation assays

    • Notch signaling regulation using reporter assays for Notch target genes

    • Protein-protein interactions (e.g., with Rer1) through co-immunoprecipitation

  • Developmental timing analysis: Track neural progenitor proliferation, differentiation, and migration during development using BrdU labeling, EdU pulse-chase experiments, and immunostaining for stage-specific markers .

  • Transcriptome analysis: RNA-seq to identify global changes in gene expression patterns resulting from TTYH1 mutations, particularly focusing on neural development pathways.

These approaches allow for comprehensive characterization of how specific TTYH1 mutations affect its various functions in neural development.

How does TTYH1's membrane-bending activity compare to other proteins?

TTYH1 exhibits distinctive membrane-bending properties that can be compared with other proteins, particularly Prominin 1 (Prom1):

These differences highlight TTYH1's unique membrane-remodeling properties, which may be linked to its specialized functions in neural tissues and development.

What techniques can be used to study TTYH1's role in extracellular vesicle formation?

Several sophisticated techniques can be employed to investigate TTYH1's role in extracellular vesicle formation:

  • Nanoparticle tracking analysis (NTA): This technique measures the size distribution and concentration of EVs produced by cells expressing TTYH1 versus controls.

  • Transmission electron microscopy (TEM): TEM has been used to visualize the morphology of EVs produced by TTYH1, revealing their tubulated structure compared to Prom1 EVs .

  • Super-resolution microscopy: Techniques like STORM or PALM can visualize TTYH1 localization during EV biogenesis with nanometer precision.

  • Live cell imaging: Using fluorescently tagged TTYH1 to track membrane deformation and EV release in real-time.

  • Proteomics analysis: Mass spectrometry of isolated EVs can identify proteins that co-package with TTYH1 and might contribute to membrane remodeling.

  • Lipid composition analysis: Lipidomics approaches can determine whether TTYH1 influences the lipid composition of EVs, potentially explaining differences in membrane tubulation.

  • Cholesterol depletion experiments: Using agents like methyl-β-cyclodextrin to manipulate membrane cholesterol levels and assess effects on TTYH1-mediated EV formation .

These methodologies provide complementary information about the molecular mechanisms of TTYH1's membrane-bending activity and EV biogenesis.

How does TTYH1 interact with the Notch signaling pathway?

TTYH1 has a unique relationship with the Notch signaling pathway that distinguishes it from other Ttyh family members:

  • Mechanism of action: TTYH1 binds to the regulator of γ-secretase activity, Rer1, in the endoplasmic reticulum and destabilizes Rer1 protein levels . This destabilization enhances γ-secretase activity, resulting in increased production of Notch intracellular domain (NICD) and activation of Notch target genes .

  • Specificity: This function is unique to TTYH1 among all Ttyh family members , suggesting structural or functional specialization not present in TTYH2 or TTYH3.

  • Functional consequence: The TTYH1-mediated enhancement of Notch signaling maintains neural stem cell properties . When TTYH1 is knocked down, cells exit the ventricular zone (VZ) and subventricular zone (SVZ) more rapidly, indicating accelerated differentiation .

  • Experimental verification: Co-expression of dominant-negative MAML1 (dnMAML1), which disrupts Notch signaling, effectively counteracts the effects of TTYH1 on neural stem cell maintenance .

  • Reversibility: Overexpression of Rer1 completely abolishes the effects of TTYH1 on NSC maintenance, confirming that Rer1 destabilization is the key step in TTYH1-dependent enhancement of γ-secretase activity .

This regulatory mechanism positions TTYH1 as a potential therapeutic target for conditions involving aberrant Notch signaling in neural development.

What is the relationship between TTYH1 and neurological disorders?

While direct links between TTYH1 and specific neurological disorders are still being elucidated, several lines of evidence suggest potential relationships:

  • Cognitive function: Ttyh1 knockout mice showed improved performance in the Morris water maze test, with shorter latency of platform searching compared to wild-type controls . This suggests TTYH1 may influence learning and memory processes.

  • Neural stem cell regulation: TTYH1's role in maintaining neural stem cell quiescence suggests that dysregulation could contribute to neurodevelopmental disorders or affect adult neurogenesis in conditions like depression, where hippocampal neurogenesis is implicated.

  • Notch signaling: TTYH1's unique regulation of Notch signaling connects it to pathways implicated in various neurodevelopmental disorders, including intellectual disability and autism spectrum disorders.

  • Retinal disorders by association: While not directly about TTYH1, studies show functional relationships between TTYH1 and Prominin 1 (Prom1) , and Prom1 mutations are associated with cone-rod retinal dystrophy (CRRD) . This suggests potential indirect involvement of TTYH1 in retinal pathologies.

  • Chloride channel function: As TTYH1 functions as a volume-sensitive chloride channel , dysfunction could potentially contribute to disorders involving neuronal excitability or cellular volume regulation.

Future research focusing specifically on TTYH1 variants in patient populations with neurodevelopmental or neurodegenerative conditions will help clarify these potential connections.

How conserved is TTYH1 across different species?

TTYH1 shows significant evolutionary conservation across species, reflecting its fundamental biological importance:

  • Phylogenetic origin: The Ttyh protein family is named after the Drosophila "tweety" gene , indicating conservation from invertebrates to mammals.

  • Mammalian homologs: Most animals have three paralogous Ttyh proteins (Ttyh1, Ttyh2, and Ttyh3) , with specific functions becoming more specialized in higher organisms.

  • Structure conservation: The five-transmembrane topology is preserved across species, though the extracellular domains show more variation .

  • Expression patterns: The predominant expression in neural tissues is consistent across species examined, including mouse, rat, human, and Xenopus tropicalis .

  • Functional conservation: Core functions such as chloride channel activity appear conserved, while regulatory roles in development may show species-specific adaptations.

Recombinant TTYH1 proteins from various species, including human, mouse, rat, bovine, and cynomolgus monkey, are available for comparative studies , facilitating cross-species functional analysis.

What experimental systems are most appropriate for studying bovine TTYH1?

Several experimental systems are particularly well-suited for studying bovine TTYH1:

  • Heterologous expression systems:

    • Mammalian cell lines (HEK293, CHO) provide appropriate post-translational modifications and membrane trafficking for functional studies .

    • Xenopus oocytes are excellent for electrophysiological characterization of ion channel properties.

  • Primary cell cultures:

    • Bovine neural stem/progenitor cells would be ideal for studying TTYH1's role in stem cell maintenance and differentiation.

    • Bovine retinal cells could be valuable for investigating TTYH1's relationship with Prominin 1 and potential roles in retinal function .

  • Organoid systems:

    • Brain organoids derived from bovine stem cells could provide a three-dimensional context for studying TTYH1's developmental functions.

  • Comparative systems:

    • Parallel studies in mouse and bovine systems can highlight species-specific aspects of TTYH1 function.

    • Given TTYH1's evolutionary conservation , insights from model organisms like mice can inform bovine-specific studies.

  • In vitro biochemical systems:

    • Reconstituted proteoliposomes containing purified bovine TTYH1 for biophysical and structural studies.

    • Cell-free expression systems for rapid production of variants for structure-function analysis.

The choice of system should be guided by the specific aspect of TTYH1 biology being investigated, whether ion channel function, membrane remodeling, or developmental regulation.

What are the most promising future research directions for TTYH1?

Several exciting research directions for TTYH1 show particular promise:

  • Structural biology: Determining the high-resolution structure of TTYH1 would provide crucial insights into its mechanism of action, particularly how it functions as both an ion channel and a membrane-bending protein.

  • Developmental neurobiology: Further investigating TTYH1's role in neural stem cell regulation could reveal new principles of brain development and potentially inform regenerative medicine approaches.

  • Extracellular vesicle biology: TTYH1's unique ability to generate tubulated EVs merits further exploration, potentially revealing new mechanisms of intercellular communication in the nervous system.

  • Notch signaling regulation: The unique mechanism by which TTYH1 enhances Notch signaling via Rer1 destabilization could be a target for therapeutic intervention in conditions involving aberrant Notch activity.

  • Translational research: Investigating potential links between TTYH1 variants and human neurological or neurodevelopmental disorders could open new diagnostic and therapeutic avenues.

  • Cross-family comparisons: Further comparative studies between TTYH1 and Prominin family proteins could reveal convergent evolution of membrane-bending mechanisms with diverse cellular functions .

These directions highlight TTYH1's position at the intersection of ion channel biology, membrane dynamics, and developmental neuroscience.

What methodological challenges remain in TTYH1 research?

Despite significant progress, several methodological challenges persist in TTYH1 research:

  • Protein expression and purification: As a multi-pass membrane protein, obtaining sufficient quantities of properly folded TTYH1 for structural and biochemical studies remains challenging .

  • Functional assays: Developing reliable, high-throughput assays for TTYH1's diverse functions—ion channel activity, membrane bending, and signaling regulation—requires sophisticated approaches.

  • Temporal control in development: Distinguishing between TTYH1's direct effects and secondary consequences in developmental processes requires precise temporal manipulation of its activity.

  • Tissue-specific functions: TTYH1 may have different functions in different cell types, requiring careful cell-type-specific genetic manipulation approaches.

  • Distinguishing from paralogs: The high similarity between TTYH1, TTYH2, and TTYH3 complicates the development of specific antibodies and inhibitors.

  • Translating to human relevance: While animal models provide valuable insights, validating TTYH1's functions in human neural development and disease requires innovative approaches using human cells and tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.