Recombinant Bovine Protein unc-50 homolog (UNC50)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For ease of use, it is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us. We will prioritize the development of your desired tag.
Synonyms
UNC50; Protein unc-50 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
UNC50
Target Protein Sequence
MLPSTSVNSPAQGNGVLSSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVFI DCVGVGLLISTLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFIN HVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSL ALGWNFTHTLCSFYKYRVK
Uniprot No.

Target Background

Function
UNC50 plays a role in the cell surface expression of neuronal nicotinic receptors. It also exhibits binding affinity for RNA.
Database Links
Protein Families
Unc-50 family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is UNC50 and what family does it belong to?

UNC50 (unc-50 inner nuclear membrane RNA binding protein) belongs to the unc-50 family of proteins. Originally identified in Caenorhabditis elegans, UNC50 is a highly conserved protein found across species from yeast to mammals. The protein has RNA-binding capabilities and is involved in several cellular processes including membrane trafficking and receptor expression . In some species and databases, UNC50 may also be referred to as GMH1, particularly in reference to the yeast homolog .

What expression pattern does UNC50 exhibit across different tissues?

UNC50 demonstrates a broad tissue distribution pattern but with notable differences in expression levels. The highest mRNA expression levels have been documented in brain, kidney, and testis tissues . This differential expression pattern suggests tissue-specific functions for UNC50, potentially related to specialized cellular activities in these organs. Researchers studying UNC50 should consider these tissue-specific expression patterns when designing experiments and interpreting results.

What are the primary molecular functions of UNC50?

UNC50 demonstrates multiple functional capabilities at the molecular level:

  • RNA binding: UNC50 has been characterized as an RNA binding protein, suggesting potential roles in RNA processing, stability, or transport .

  • Membrane receptor trafficking: Studies in C. elegans indicate that UNC50 is involved in the cell surface expression of neuronal nicotinic receptors . This function appears to be evolutionarily conserved.

  • Cell cycle regulation: Research on hepatocellular carcinoma (HCC) has implicated UNC50 in promoting G1/S transition and cellular proliferation, suggesting broader roles in cell cycle control .

These diverse functions highlight UNC50 as a multifunctional protein with potential significance in various cellular processes.

How is UNC50 involved in cellular trafficking mechanisms?

UNC50's role in cellular trafficking appears to be conserved across species, though with some functional specialization. In C. elegans, UNC50 is specifically involved in the trafficking of nicotinic acetylcholine receptors to the cell surface . This function is particularly important in neuronal cells where proper receptor localization is critical for synaptic transmission.

The protein's localization to either the Golgi apparatus (in yeast) or the inner nuclear membrane (in mammalian cells) positions it strategically within the cellular membrane system . This positioning may facilitate its involvement in the transport and processing of various cellular components, including membrane receptors. Researchers investigating UNC50's role in trafficking should consider employing techniques such as fluorescent-tagged protein tracking, subcellular fractionation, and co-immunoprecipitation to identify trafficking partners.

What are recommended methods for detecting UNC50 protein expression?

Several complementary methods can be employed to detect and quantify UNC50 protein expression:

  • Western Blotting: Using specific antibodies such as Anti-UNC50 Rabbit Polyclonal Antibody. The recommended working dilution for western blotting is 1 μg/ml .

  • Immunocytochemistry/Immunofluorescence: For subcellular localization studies, researchers can use tagged UNC50 constructs (e.g., hemagglutinin-tagged UNC50) or specific antibodies against UNC50 .

  • Flow Cytometry: This technique can be used to assess UNC50 expression levels in different cell populations, particularly when studying the effects of UNC50 knockdown or overexpression .

  • Mass Spectrometry: For more detailed proteomic analysis, mass spectrometry can identify UNC50 and its potential post-translational modifications.

Each method has specific advantages and limitations, and researchers should select the appropriate approach based on their experimental goals and available resources.

What are effective strategies for modulating UNC50 expression in experimental systems?

Researchers have successfully employed several approaches to modulate UNC50 expression:

Knockdown Strategies:

  • siRNA transfection has been successfully used in cell lines such as Hep3B to reduce UNC50 expression .

  • shRNA constructs can be employed for more stable knockdown experiments.

  • CRISPR-Cas9 genome editing can be used for complete knockout studies in appropriate cell lines.

Overexpression Strategies:

  • Transfection with expression vectors containing the UNC50 coding sequence under strong promoters (e.g., CMV) .

  • Viral delivery systems (lentiviral, adenoviral) for more difficult-to-transfect cell types.

  • Inducible expression systems for temporal control of UNC50 overexpression.

When designing these experiments, researchers should include appropriate controls and validate the efficiency of knockdown or overexpression using methods such as quantitative real-time PCR and western blotting .

How does UNC50 influence cell cycle progression and proliferation?

UNC50 has been implicated in cell cycle regulation, particularly in hepatocellular carcinoma (HCC). Research has shown that UNC50 promotes G1/S transition, a critical checkpoint in the cell cycle . Experimental approaches to study this function include:

  • Flow cytometry analysis: After UNC50 knockdown or overexpression, researchers can assess the distribution of cells in different phases of the cell cycle.

  • Proliferation assays: Tetrazolium-based assays have been used to measure the effect of UNC50 on cellular proliferation rates .

  • Expression analysis of cell cycle regulators: Following UNC50 modulation, researchers can examine changes in the expression of key cell cycle proteins using western blotting or quantitative PCR.

  • Microarray analysis: Global gene expression profiling has been employed to identify downstream targets of UNC50 in Hep3B cells .

This research area holds particular promise for understanding UNC50's potential role in pathological conditions such as cancer.

What methodological challenges exist when working with recombinant UNC50?

Researchers working with recombinant UNC50 may face several challenges:

  • Protein solubility: As a transmembrane protein, UNC50 may present solubility issues during recombinant expression and purification . Detergent optimization or fusion tag approaches may be necessary.

  • Maintaining native conformation: Ensuring that recombinant UNC50 maintains its physiological structure and function is critical, particularly for functional studies.

  • Species-specific differences: Researchers should be aware that UNC50 from different species may have subtle functional differences despite the high sequence conservation .

  • Validation of interaction partners: Confirming RNA binding specificity and identifying relevant physiological RNA targets requires carefully designed experiments.

To address these challenges, researchers should consider using multiple complementary approaches and include appropriate controls to validate their findings.

What is the relationship between UNC50 and hepatocellular carcinoma?

UNC50 has been specifically studied in the context of hepatocellular carcinoma (HCC), revealing several important findings:

AspectFindings in HCCMethodology
Expression levelsUNC50 mRNA is differentially expressed in HCC vs. adjacent non-cancerous tissuesNorthern blotting, Real-time PCR on 44 paired tissue samples
Functional rolePromotes G1/S transition and cellular proliferationFlow cytometry, tetrazolium assay
Molecular mechanismsGlobal effects identified through microarray analysisMicroarray experiments on UNC50 knockdown Hep3B cells
Validation approachEffects confirmed in both overexpression and knockdown systemsReal-time PCR, western blotting

These findings suggest that UNC50 may have potential as a biomarker or therapeutic target in HCC, though more research is needed to fully elucidate its role in cancer development and progression.

What experimental models are appropriate for studying UNC50 in disease contexts?

Several experimental models have been successfully employed to study UNC50 in disease contexts:

  • Cell line models: Hepatocellular carcinoma cell lines such as Hep3B have been used to study UNC50's role in cancer cell proliferation and cell cycle regulation .

  • Patient-derived tissue samples: Paired HCC and adjacent non-cancerous tissues have provided valuable insights into UNC50 expression patterns in human disease .

  • Animal models: While not explicitly detailed in the provided search results, the conservation of UNC50 across species suggests that animal models (from C. elegans to mammals) could be valuable for studying its function in vivo .

When selecting an experimental model, researchers should consider the specific aspect of UNC50 biology they aim to investigate, as different models may be more appropriate for certain questions.

How can researchers address antibody specificity challenges when studying UNC50?

Ensuring antibody specificity is crucial for obtaining reliable results in UNC50 research. Researchers should consider the following approaches:

  • Validation in knockout/knockdown systems: Testing antibodies in systems where UNC50 expression has been experimentally reduced or eliminated can confirm specificity .

  • Multiple antibody approach: Using different antibodies targeting distinct epitopes of UNC50 can increase confidence in detection specificity.

  • Recombinant protein controls: Including purified recombinant UNC50 as a positive control in immunodetection experiments.

  • Pre-absorption controls: Pre-incubating antibodies with recombinant UNC50 protein to demonstrate specific blocking of the signal.

For commercially available antibodies, such as the Anti-UNC50 Rabbit Polyclonal Antibody, researchers should follow the manufacturer's recommended working dilutions (e.g., 1 μg/ml for western blotting) .

What bioinformatic resources are available for UNC50 research?

Researchers studying UNC50 can utilize several bioinformatic resources:

  • Sequence databases: NCBI provides comprehensive sequence information for UNC50 across multiple species, facilitating comparative analyses .

  • Expression databases: Resources containing tissue-specific expression data can inform experimental design and interpretation.

  • Protein structure prediction: Since detailed structural information may be limited, prediction tools can provide insights into UNC50's structural features.

  • Interactome databases: These can help identify potential interaction partners for UNC50, guiding co-immunoprecipitation or other interaction studies.

  • Pathway analysis tools: For interpreting large-scale experiments such as microarray data following UNC50 manipulation .

These resources can significantly enhance research efficiency and provide valuable context for experimental findings.

What are emerging areas of interest in UNC50 research?

Based on current knowledge, several promising research directions for UNC50 include:

  • Detailed structural characterization: Elucidating the three-dimensional structure of UNC50 would provide insights into its molecular function and potential druggability.

  • RNA target identification: Comprehensive identification of the RNA molecules that interact with UNC50 could reveal new functional aspects of this protein .

  • Role in other cancers: Expanding research beyond hepatocellular carcinoma to investigate UNC50's potential involvement in other malignancies .

  • Therapeutic targeting: Exploring UNC50 as a potential therapeutic target in diseases where its dysregulation contributes to pathology.

  • Intersection with other cellular pathways: Investigating how UNC50's functions in receptor trafficking and cell cycle regulation might intersect with other critical cellular processes .

These research directions could significantly advance our understanding of UNC50 biology and its relevance to human health and disease.

What methodological advances would benefit UNC50 research?

Several technological and methodological advances could significantly enhance UNC50 research:

  • CRISPR-based approaches: Application of CRISPR-Cas9 technology for precise genome editing to study UNC50 function in various cellular contexts.

  • Single-cell analysis: Employing single-cell RNA sequencing or proteomics to understand cell-to-cell variability in UNC50 expression and function.

  • Advanced imaging techniques: Super-resolution microscopy could provide more detailed insights into UNC50's subcellular localization and dynamics.

  • Protein-protein interaction mapping: Techniques such as BioID or proximity labeling could help identify the UNC50 interactome in different cellular compartments.

  • Integrative multi-omics approaches: Combining transcriptomic, proteomic, and metabolomic data to understand UNC50's role in cellular physiology more comprehensively.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.