Recombinant Bovine Proteinase-activated receptor 2 (F2RL1)

Shipped with Ice Packs
In Stock

Description

Mechanisms of Activation

PAR2 activation involves proteolytic cleavage or synthetic peptides mimicking its tethered ligand:

  • Proteolytic activation: Trypsin cleaves between Arg⁴¹ and Ser⁴², unmasking the ligand SFLLRN, which binds extracellular loop 2 (ECL2) to trigger signaling .

  • Non-proteolytic activation: Peptide agonists like 2-at-LIGRL-NH₂ directly bind ECL2, inducing conformational changes .

  • Downstream pathways: Activates phospholipase C (PLC), MAPK, NF-κB, and calcium signaling, modulating inflammation, pain, and cell survival .

Research Applications

Recombinant Bovine F2RL1 is utilized to study:

Inflammatory and Immune Responses

  • PAR2 activation suppresses pro-inflammatory cytokines (e.g., IFN-γ, IL-12) in colitis models, highlighting its anti-inflammatory potential .

  • Synergizes with Toll-like receptors (TLR4, TLR2) to amplify immune responses during infections .

Tissue Regeneration and Disease

  • Essential for β-cell survival during pancreatitis and liver regeneration post-injury .

  • Linked to sensory neuron activation in pain and itch pathways, with implications for dermatological disorders .

Cancer and Metabolism

  • Promotes tumor progression via EGFR transactivation and metastatic signaling .

  • Modulates obesity-related metabolic dysregulation .

Pathways and Protein Interactions

Recombinant Bovine F2RL1 participates in diverse pathways, as shown below:

PathwayKey Associated Proteins
Neuroactive ligand-receptor interactionGRM6, GALR3, HTR1F
Inflammatory mediator regulation of TRP channelsTRPV1, NGF, PIK3CB
African trypanosomiasisTNF, IL1B2, FASLG

Protein Functions:

  • G-protein coupled receptor activity: Binds Gα and Gβ subunits to initiate signaling .

  • Receptor for trypsin/tryptase: Mediates protease-driven inflammatory responses .

  • Cross-talk with TLR4/EGFR: Enhances innate immunity and tissue repair .

Current Research Findings

Recent studies using recombinant PAR2 tools reveal:

  • Sensory neuron specificity: PAR2 activation in Trpv1⁺/CGRP⁻ dorsal root ganglion neurons induces mechanical allodynia but not thermal pain .

  • Therapeutic targeting: PAR2 antagonists show promise in reducing chronic inflammation and pain in murine models .

  • Transdifferentiation regulation: PAR2 knockout mice fail to induce islet cell plasticity during β-cell deficiency .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
F2RL1; PAR2; Proteinase-activated receptor 2; PAR-2; Coagulation factor II receptor-like 1; Thrombin receptor-like 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-395
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
SLIGNVDNSPVVAGRGVTVKPGFSVDEFSTSVLTGKLTTVFLPVVYTIVFVVGLPSNGMA LWVFLFRTKKKHPAVIYMANLALADLLSVTWFPLKIAYHIHGNNWIYGESLCKVLIGFFY GNMYCSILFMTCLSVQRYWVIVNPMVHPKKQANIAIGVSLGIWLLILLLTIPLYVVKQTS YIRALNITTCHDVLPEEVLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRTLQSSAMDE SSGKKRRRAIKLIVTVLAMYLICFTPSNLLLVVHYFLIKTRGQSHVYALYIVALCLSTLN SCIDPFVYYFISQDFRDHAKNALLCRSVRTVKRMQVSLSSKKFSGKSSSYSSSSTSVKGS Y
Uniprot No.

Target Background

Function
Protease-activated receptor 2 (PAR2), also known as F2RL1, is a G protein-coupled receptor that serves as a receptor for trypsin and trypsin-like enzymes. Its activation triggers various signaling pathways, including phospholipase C (PLC), intracellular calcium, mitogen-activated protein kinase (MAPK), I-kappaB kinase/NF-kappaB, and Rho. PAR2 can also be transactivated by cleaved F2R/PAR1. PAR2 plays a crucial role in modulating inflammatory responses, regulating both innate and adaptive immunity, and acts as a sensor for proteolytic enzymes generated during infection. Generally, PAR2 promotes inflammation. It can signal synergistically with TLR4 and potentially TLR2 in inflammatory responses and modulates TLR3 signaling. PAR2 exhibits a protective role in maintaining the endothelial barrier, a function involving coagulation factor X. It regulates endothelial cell barrier integrity during neutrophil extravasation, likely following proteolytic cleavage by PRTN3. PAR2 is proposed to have a bronchoprotective role in airway epithelium but has also been shown to compromise the airway epithelial barrier by disrupting E-cadherin adhesion. PAR2 is involved in regulating vascular tone. Its activation leads to hypotension, presumably mediated by vasodilation. PAR2 associates with a subset of G protein alpha subunits, including GNAQ, GNA11, GNA14, GNA12, and GNA13, but likely not with G(o) alpha, G(i) subunit alpha-1, and G(i) subunit alpha-2. It is believed to be a class B receptor that internalizes as a complex with arrestin and traffics with it to endosomal vesicles, potentially as a desensitized receptor, for extended periods. PAR2 mediates inhibition of TNF-alpha-stimulated JNK phosphorylation via coupling to GNAQ and GNA11. This function involves dissociation of RIPK1 and TRADD from TNFR1. PAR2 mediates phosphorylation of the nuclear factor NF-kappa-B RELA subunit at 'Ser-536'. This function involves IKBKB and is largely independent of G proteins. PAR2 is involved in cellular migration. It is involved in cytoskeletal rearrangement and chemotaxis through beta-arrestin-promoted scaffolds. This function is independent of GNAQ and GNA11 and involves promoting cofilin dephosphorylation and actin filament severing. PAR2 induces redistribution of COPS5 from the plasma membrane to the cytosol, and activation of the JNK cascade is mediated by COPS5. PAR2 participates in the recruitment of leukocytes to sites of inflammation and is the primary PAR receptor capable of modulating eosinophil function, including proinflammatory cytokine secretion, superoxide production, and degranulation. During inflammation, PAR2 promotes dendritic cell maturation, trafficking to the lymph nodes, and subsequent T-cell activation. PAR2 is involved in the antimicrobial response of innate immune cells; activation enhances phagocytosis of Gram-positive bacteria and killing of Gram-negative bacteria. PAR2 acts synergistically with interferon-gamma in enhancing antiviral responses.
Gene References Into Functions
  1. PAR1 and PAR2 regulate endothelial NO synthase phosphorylation and activity through G(12/13) and G(q), delineating the signaling pathways by which the proteases act on protease-activated receptors to modulate endothelial functions. PMID: 19064814
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is F2RL1 and what are its primary functional domains?

F2RL1, also known as Proteinase-activated receptor 2 (PAR2), is a G-protein-coupled receptor that plays significant roles in inflammation and fibrosis. The receptor contains an extracellular N-terminal domain with a tethered ligand sequence that becomes exposed after proteolytic cleavage. This unique activation mechanism distinguishes it from conventional ligand-receptor interactions. The receptor's structure includes seven transmembrane domains, three extracellular loops, three intracellular loops, and a C-terminal tail that mediates downstream signaling cascades. PAR2 is highly expressed in renal tubular cells and various other tissues, making it an important target for investigating disease pathogenesis .

How does the activation mechanism of F2RL1/PAR2 differ from other G-protein coupled receptors?

Unlike conventional G-protein coupled receptors that require reversible binding of soluble ligands, PAR2 activation occurs through proteolytic cleavage of its N-terminal domain by serine proteases such as trypsin, pancreatic trypsin, and thrombin . This irreversible cleavage exposes a tethered ligand sequence that binds to the receptor's second extracellular loop, triggering conformational changes and subsequent signaling. This unique mechanism represents a form of post-translational regulation that enables cells to respond to protease activity in their microenvironment. Researchers studying recombinant bovine PAR2 must consider this activation mechanism when designing experiments, as traditional competitive binding assays may not be applicable.

What signaling pathways are activated downstream of F2RL1/PAR2?

PAR2 activation initiates multiple signaling cascades including:

  • MAPK pathway: PAR2 stimulation leads to phosphorylation of p42/44 MAP kinase, contributing to cell proliferation and differentiation responses.

  • TGFβ receptor pathway: PAR2 can transactivate the TGFβ receptor, leading to Smad2/3 phosphorylation and subsequent profibrotic gene expression .

  • EGFR transactivation: PAR2 activation can lead to transactivation of the Epidermal Growth Factor Receptor, amplifying downstream signaling.

  • PI3K pathway: PAR2 stimulation can activate the phosphatidylinositide 3-kinase pathway, influencing cell survival and metabolism.

These pathways often exhibit crosstalk, creating a complex signaling network that regulates cellular responses to PAR2 activation in context-dependent manners.

What are the optimal methods for activating recombinant bovine F2RL1 in experimental settings?

Researchers can activate recombinant bovine F2RL1/PAR2 through several established methods:

Control experiments should include inactive reverse-sequence peptides corresponding to the PAR2-activating peptides to confirm specificity of observed effects.

What cell models are most appropriate for studying bovine F2RL1 signaling mechanisms?

The choice of cell model depends on the specific research question:

  • Primary bovine cells: Primary cells derived from bovine tissues (kidney, lung, intestine) provide the most physiologically relevant context but may have limited lifespan and experimental reproducibility.

  • Immortalized bovine cell lines: These offer better reproducibility while maintaining some tissue-specific characteristics.

  • Heterologous expression systems: Human cell lines (like HEK293 or HeLa) transfected with bovine F2RL1 allow for controlled expression levels and are useful for signaling studies, though they lack the native cellular context.

  • Species-specific considerations: When studying bovine F2RL1, researchers should be aware that human proximal tubular epithelial cells (HPTC) have been effectively used for PAR2 research , but species differences in receptor sequence and signaling may exist between human and bovine systems.

For signaling studies, serum starvation for 24 hours prior to stimulation is recommended to reduce baseline activation of pathways like MAPK and Smad that might mask PAR2-specific effects .

What experimental readouts should be used to assess F2RL1 activation in different experimental contexts?

Readout TypeMethodTimepointAdvantagesLimitations
Receptor ActivationCalcium flux assaysSeconds - minutesImmediate response, quantitativeTransient, requires fluorescent dyes
Early SignalingPhospho-MAPK Western blot5-60 minutesWell-established biomarkerMultiple pathways can activate MAPK
TGFβ PathwayPhospho-Smad2/3 Western blot15-60 minutesSpecific to TGFβ signalingMay be activated by other receptors
Transcriptional ResponseqPCR for CTGF expression24 hoursFunctional readoutInfluenced by multiple factors
Phenotypic ResponseFibrosis markers (α-SMA, collagen)24-72 hoursDisease-relevant endpointRequires longer experiments

Researchers should select readouts based on their specific research questions. For mechanistic studies of signaling pathways, examining phosphorylation events at multiple time points (5, 15, 30, and 60 minutes) is recommended . For functional outcomes, assessing gene expression changes at 24 hours or longer is more appropriate.

How does F2RL1 contribute to renal fibrosis and what experimental models best demonstrate this?

F2RL1/PAR2 plays a significant role in renal fibrosis through several mechanisms:

  • Profibrotic gene induction: PAR2 activation upregulates connective tissue growth factor (CTGF) expression, a potent profibrotic cytokine that promotes extracellular matrix production .

  • TGFβ pathway synergy: PAR2 synergizes with the TGFβ signaling pathway, amplifying Smad2/3 phosphorylation and subsequent profibrotic gene expression .

  • EGFR transactivation: PAR2 can transactivate the EGFR, initiating additional signaling cascades that contribute to fibrotic responses .

Experimental models that effectively demonstrate these mechanisms include:

  • In vivo: Unilateral ureteric obstruction in wild-type versus PAR2-deficient mice. Studies show that PAR2-deficient mice displayed reduced renal tubular injury, fibrosis, collagen synthesis, CTGF, and α-smooth muscle actin gene expression at 7 days post-obstruction compared to wild-type controls .

  • In vitro: Human proximal tubular epithelial cells treated with PAR2-activating peptides with or without TGFβ1. This model demonstrates the synergistic effect of PAR2 activation and TGFβ on profibrotic signaling .

When designing experiments, researchers should include both PAR2 activation alone and in combination with TGFβ to observe the synergistic effects that may be particularly relevant to disease pathogenesis.

What is the relationship between F2RL1 expression and cancer progression, particularly in cervical cancer?

Recent research has uncovered significant relationships between F2RL1/PAR2 expression and cervical cancer (CCa) progression:

Researchers interested in studying the role of bovine F2RL1 in cancer should consider comparative analyses with human studies and employ appropriate cancer models relevant to bovine pathology.

How does F2RL1/PAR2 interact with the immune system in disease contexts?

F2RL1/PAR2 demonstrates complex interactions with the immune system that can significantly impact disease progression:

  • Inverse correlation with immune infiltration: High F2RL1 expression correlates with reduced infiltration of various immune cell types, including T follicular helper (TFH) cells, cytotoxic cells, T cells, NK cells, Treg cells, B cells, and dendritic cells .

  • Relationship with immune checkpoints: F2RL1 expression shows inverse proportional relationships with immune checkpoint molecules including PD-1 (PDCD1), PD-L1 (CD274), CTLA4, TIM3 (HAVCR2), BTLA, LAG3, TIGIT, LILRB2, LILRB4, IDO1, SIGLEC7, and VSIR .

  • Impact on survival in immune contexts: Survival analyses reveal significant differences in outcomes between high and low F2RL1 expression groups across various immune cell populations, including CD4+, CD8+, NK cells, eosinophils, basophils, macrophages, and mesenchymal stem cells .

  • Co-expression with immune-related genes: F2RL1 shows significant correlations with immune-related genes, with top positive correlations to AREG, LIF, BMP4, SEMA4G, and FGF5, and negative correlations with CXCL13, CCL19, PNOC, GKN1, and NPPC .

These findings suggest that F2RL1/PAR2 may contribute to immune evasion mechanisms in disease contexts, potentially through modulation of the tumor microenvironment and immune cell function.

How does F2RL1/PAR2 transactivate other receptor signaling pathways?

F2RL1/PAR2 engages in complex transactivation mechanisms with other receptor systems, particularly EGFR and TGFβ receptors:

  • EGFR transactivation: PAR2 activation can lead to the release of EGFR ligands through metalloproteinase-dependent mechanisms. This involves activation of matrix metalloproteinases (MMPs) that cleave membrane-bound EGFR ligands, resulting in their release and subsequent EGFR activation. This mechanism creates signaling amplification, where PAR2 activation leads to secondary EGFR signaling .

  • TGFβ receptor transactivation: PAR2 stimulation induces Smad2/3 phosphorylation in the canonical TGFβ signaling pathway. Importantly, this phosphorylation requires signaling via both the TGFβ receptor and EGF receptor, suggesting a multilayered transactivation mechanism .

  • Convergent signaling: PAR2 activation and TGFβ signaling converge to synergistically increase the expression of profibrotic factors like CTGF. This convergence may occur at the level of transcription factors or chromatin modifiers that integrate signals from multiple pathways .

  • Bidirectional regulation: In some contexts, TGFβ signaling may enhance PAR2 expression, creating a positive feedback loop that amplifies profibrotic responses.

Understanding these transactivation mechanisms is crucial for designing targeted interventions, as inhibiting a single pathway may not effectively disrupt the integrated signaling network.

What are the key structural differences between bovine F2RL1 and its human counterpart that might affect experimental design?

While the search results don't specifically address structural differences between bovine and human F2RL1, researchers should consider several potential differences that might affect experimental design:

  • Sequence homology: Bovine and human F2RL1 share significant sequence homology, but differences in key regions such as the extracellular N-terminus (containing the protease cleavage site) or intracellular signaling domains may affect receptor activation or downstream signaling.

  • Glycosylation patterns: Differences in post-translational modifications, particularly glycosylation, may affect protease accessibility, receptor trafficking, or ligand recognition.

  • Protease specificity: Different sensitivity to activating proteases may exist between bovine and human F2RL1, requiring species-specific optimization of protease concentrations for receptor activation.

  • Signaling partners: Differences in the expression or structure of downstream signaling partners may result in species-specific signaling outcomes even with identical receptor activation.

  • Pharmacological selectivity: PAR2-activating peptides designed based on the human tethered ligand sequence may have different potency or efficacy at bovine PAR2.

Researchers working with recombinant bovine F2RL1 should validate activation methods and signaling readouts specifically in bovine systems rather than assuming direct translation from human studies.

What epigenetic mechanisms regulate F2RL1 expression in different tissues and disease states?

While the provided search results don't specifically address epigenetic regulation of F2RL1, researchers investigating this aspect should consider several potential mechanisms:

  • DNA methylation: The F2RL1 promoter region may contain CpG islands subject to differential methylation in different tissues or disease states. Hypomethylation of the promoter could contribute to the elevated expression observed in cancer tissues.

  • Histone modifications: Activating (H3K4me3, H3K27ac) or repressive (H3K27me3, H3K9me3) histone marks may dynamically regulate F2RL1 expression in response to environmental cues or disease progression.

  • Chromatin accessibility: Changes in chromatin structure mediated by remodeling complexes could affect transcription factor access to the F2RL1 locus.

  • microRNA regulation: Post-transcriptional regulation by microRNAs targeting F2RL1 mRNA may contribute to tissue-specific expression patterns.

  • Transcription factor occupancy: Disease-specific transcription factors may bind the F2RL1 promoter or enhancers in pathological conditions, potentially explaining the elevated expression in cancer contexts.

Researchers investigating epigenetic regulation of bovine F2RL1 should consider employing techniques such as bisulfite sequencing, ChIP-seq, ATAC-seq, and RNA-seq to comprehensively characterize the epigenetic landscape at the F2RL1 locus in different bovine tissues and disease models.

What strategies can be employed to specifically inhibit F2RL1/PAR2 function in experimental systems?

Researchers have several options for inhibiting F2RL1/PAR2 function, each with distinct advantages and limitations:

  • Genetic approaches:

    • CRISPR/Cas9 knockout: Complete elimination of F2RL1 expression, useful for establishing its necessity in biological processes.

    • siRNA/shRNA knockdown: Reduces F2RL1 expression without complete elimination, allowing for dose-dependent studies.

    • Dominant-negative mutants: Expression of signaling-deficient F2RL1 that competes with wildtype receptor.

  • Pharmacological approaches:

    • Pepducins: Lipidated peptides that interfere with coupling between PAR2 and G proteins.

    • Small molecule antagonists: Compounds that bind PAR2 and prevent its activation.

    • Protease inhibitors: Block the activating proteases upstream of PAR2, though this approach lacks specificity.

  • Biological approaches:

    • Blocking antibodies: Target the receptor's extracellular domains to prevent tethered ligand binding.

    • Engineered proteases: Modified to cleave and inactivate PAR2 rather than activate it.

In animal models, PAR2-deficient mice have demonstrated attenuated renal fibrosis following unilateral ureteric obstruction, showing reduced tubular injury, fibrosis, collagen synthesis, and profibrotic gene expression compared to wild-type controls . This genetic approach provides strong evidence for PAR2's role in disease pathogenesis.

How can researchers distinguish between direct F2RL1 signaling effects and indirect effects through receptor transactivation?

Distinguishing direct F2RL1 signaling from effects mediated through receptor transactivation requires systematic experimental strategies:

  • Selective inhibitor approach:

    • Apply PAR2-activating peptides in the presence or absence of inhibitors for potentially transactivated receptors (e.g., EGFR inhibitors like gefitinib or TGFβ receptor inhibitors like SB431542).

    • If the response persists despite inhibition of the secondary receptor, it suggests direct PAR2 signaling.

    • Research has shown that Smad2 phosphorylation and CTGF induction by PAR2 activation required signaling via both TGFβ receptor and EGF receptor, indicating transactivation mechanisms .

  • Temporal resolution:

    • Monitor signaling events with high temporal resolution to identify the sequence of activation.

    • Direct PAR2 signaling (e.g., calcium flux, early MAPK activation) typically occurs within seconds to minutes.

    • Transactivation events often follow with slight delays.

  • Receptor-specific readouts:

    • Utilize readouts highly specific to particular signaling pathways (e.g., Smad2/3 phosphorylation for TGFβ signaling).

    • Compare the pattern and kinetics of activation between direct PAR2 stimulation and activation of the putatively transactivated receptor.

  • Genetic approach:

    • Use cells lacking the potentially transactivated receptor (e.g., EGFR knockout cells).

    • If PAR2 responses are abolished or significantly altered, it suggests dependence on the transactivation mechanism.

These complementary approaches can help researchers delineate the complex signaling networks downstream of PAR2 activation.

What are the most promising therapeutic strategies targeting F2RL1/PAR2 for kidney and cancer diseases?

Based on the research findings, several therapeutic strategies targeting F2RL1/PAR2 show promise for kidney and cancer diseases:

  • For kidney fibrosis:

    • PAR2 antagonists: Direct inhibition of PAR2 could attenuate profibrotic signaling in kidney disease .

    • Dual-targeting approaches: Combining PAR2 inhibition with TGFβ pathway inhibitors may provide synergistic anti-fibrotic effects given their convergent signaling .

    • EGFR inhibition: Blocking the transactivation of EGFR by PAR2 could disrupt a key signaling node in fibrosis progression .

  • For cervical cancer:

    • Early detection: F2RL1 shows potential as an early biomarker for cervical cancer, with significant expression increases in ASCUS stage and HPV infection .

    • Immune modulation: Given F2RL1's inverse correlation with immune cell infiltration, combining PAR2 inhibition with immunotherapies might enhance anti-tumor immune responses .

    • Targeted therapy: Developing specific inhibitors against F2RL1 might be effective, particularly in patients with high F2RL1 expression who show poorer survival outcomes .

    • Diagnostic applications: F2RL1 detection in serum and cervical samples could serve as an adjunct or alternative to HPV and TCT testing for early cervical cancer detection .

  • General considerations:

    • Patient stratification: Therapeutic approaches should consider F2RL1 expression levels, as high expressors show distinct clinical outcomes and may benefit most from targeted therapy .

    • Combination strategies: Given PAR2's involvement in multiple signaling pathways, combination approaches targeting both PAR2 and its downstream or transactivated pathways may be most effective.

How might studying bovine F2RL1 contribute to comparative understanding of receptor function across species?

Studying bovine F2RL1 offers unique opportunities for comparative biology and translational research:

  • Evolutionary conservation: Analysis of functional domains across species can reveal evolutionarily conserved regions that are likely critical for receptor function. Highly conserved regions between bovine and human F2RL1 may represent essential functional domains, while divergent regions might reflect species-specific adaptations.

  • Differential protease sensitivity: Comparing the N-terminal domains of bovine and human F2RL1 may reveal differences in protease cleavage sites and sensitivities, providing insights into species-specific regulation of receptor activation.

  • Species-specific pathologies: Bovine-specific diseases involving F2RL1 may reveal novel functions or regulatory mechanisms not evident in human or rodent models. These could provide unexpected insights applicable to human health.

  • Structural biology contributions: Recombinant bovine F2RL1 may offer advantages for structural studies if it expresses at higher levels or exhibits greater stability than human F2RL1, potentially facilitating crystallography or cryo-EM studies.

  • Agricultural applications: Understanding bovine F2RL1 function could contribute to addressing bovine diseases, with potential economic implications for agriculture and animal health.

By examining F2RL1 function across species, researchers can distinguish fundamental mechanisms from species-specific adaptations, enhancing our understanding of receptor biology and potentially revealing novel therapeutic approaches.

What are the key challenges in developing highly specific activators or inhibitors of F2RL1/PAR2?

Developing specific modulators for F2RL1/PAR2 presents several significant challenges:

  • Unique activation mechanism: Unlike conventional receptors, PAR2 is activated by proteolytic cleavage that exposes a tethered ligand. This irreversible activation mechanism complicates the design of reversible inhibitors.

  • Structural complexity: The binding site for the tethered ligand involves complex interactions between the exposed N-terminus and the second extracellular loop. This intricate binding pocket presents challenges for structure-based drug design.

  • PAR family homology: High sequence similarity between PAR family members (PAR1, PAR2, PAR3, PAR4) in key domains makes achieving selectivity difficult. Compounds must be extensively screened against all PAR family members.

  • Species differences: Variations in receptor sequence between species may affect ligand binding and activation, complicating translational research. Compounds developed against bovine F2RL1 may have different properties when tested against human PAR2.

  • Multiple activation modes: PAR2 can be activated by various proteases that may cleave at slightly different sites, potentially exposing different versions of the tethered ligand. Inhibitors may need to block multiple activation modes.

  • Biased signaling: PAR2 can activate multiple signaling pathways, and different activators may preferentially engage specific pathways (biased agonism). Developing pathway-selective modulators requires sophisticated screening and validation approaches.

Strategies to overcome these challenges include fragment-based drug discovery approaches, allosteric modulator development, and high-throughput screening against specific PAR2 activation readouts.

What novel methodologies might advance our understanding of F2RL1 signaling dynamics in live cells?

Cutting-edge methodologies that could significantly advance F2RL1 signaling research include:

  • CRISPR-based fluorescent tagging: Endogenous tagging of F2RL1 and key signaling components with fluorescent proteins allows for tracking of receptor trafficking, clustering, and protein-protein interactions in live cells without overexpression artifacts.

  • Optogenetic PAR2 variants: Engineering light-activated versions of PAR2 would enable precise spatiotemporal control of receptor activation, allowing researchers to study downstream signaling events with unprecedented resolution.

  • Biosensors for real-time signaling: Developing FRET-based or fluorescent biosensors for key PAR2 signaling events (G protein activation, β-arrestin recruitment, MAPK activation) would enable visualization of signaling dynamics in live cells.

  • Single-molecule imaging: Techniques like single-particle tracking could reveal the dynamics of individual PAR2 molecules on the cell surface, providing insights into receptor diffusion, clustering, and interactions with signaling partners.

  • Proximity labeling proteomics: Methods like BioID or APEX2 fused to PAR2 could identify proteins that transiently interact with the receptor upon activation, revealing the dynamic composition of signaling complexes.

  • Spatial transcriptomics/proteomics: Analyzing the spatial distribution of transcriptional or proteomic changes following PAR2 activation could reveal localized signaling events within specific cellular compartments.

  • Microfluidic approaches: Controlling the exposure of cells to PAR2 activators using microfluidic devices could enable studies of receptor desensitization, resensitization, and adaptation to gradients of activating proteases.

These advanced methodologies could provide unprecedented insights into the dynamics and complexity of PAR2 signaling, potentially revealing novel regulatory mechanisms and therapeutic opportunities.

How can systems biology approaches enhance our understanding of F2RL1 in complex disease networks?

Systems biology approaches offer powerful frameworks for understanding F2RL1's role in disease pathogenesis:

  • Network analysis: Integration of protein-protein interaction data, signaling pathways, and gene regulatory networks can place F2RL1 within larger biological systems. Research has already identified interactions between F2RL1 and 43 immune-related genes, constructing an interaction network that includes hub genes like LIF, FGF3, CXCL5, GAST, FGF5, FGF20, FGF19, and CXCL13 .

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data can reveal how F2RL1 activation affects cellular states across multiple levels of biological organization. Functional enrichment analyses have shown F2RL1's association with biological processes such as cilium movement, microtubule bundle formation, and axoneme assembly, as well as involvement in pathways like neuroactive ligand-receptor interaction and bile secretion .

  • In silico modeling: Computational models of PAR2 signaling pathways can generate testable hypotheses about pathway crosstalk and feedback mechanisms. Models incorporating PAR2 transactivation of EGFR and TGFβ receptors could predict intervention points with maximal therapeutic impact.

  • Machine learning approaches: Analysis of large datasets can identify patterns and correlations that might not be apparent through traditional approaches. Machine learning has already demonstrated F2RL1's potential as a biomarker with an AUC of 0.996 in ROC analysis for cervical cancer detection .

  • Patient stratification: Computational clustering of patient data based on F2RL1 expression and associated molecular features can identify distinct patient subgroups that might benefit from different therapeutic approaches. Research has shown significant survival differences between patients with high versus low F2RL1 expression across parameters like OS, PFS, and PFI .

By integrating F2RL1 into larger biological systems, researchers can develop more comprehensive understanding of its disease roles and identify novel therapeutic strategies targeting key nodes or feedback mechanisms.

What bioinformatic tools and databases are most valuable for researchers studying F2RL1 across species?

Researchers studying F2RL1 across species should consider utilizing the following bioinformatic resources:

  • Sequence databases and analysis tools:

    • UniProt: For comprehensive protein sequence and functional annotation

    • NCBI Protein: For sequences across multiple species

    • Clustal Omega: For multiple sequence alignment to identify conserved domains

    • ConSurf: For identification of functionally important regions based on evolutionary conservation

  • Structural biology resources:

    • PDB (Protein Data Bank): For experimental structures of F2RL1 or related proteins

    • AlphaFold DB: For AI-predicted protein structures

    • PyMOL/UCSF Chimera: For visualization and analysis of protein structures

    • SwissModel: For homology modeling of bovine F2RL1 based on available templates

  • Gene expression databases:

    • GEO (Gene Expression Omnibus): For expression data across tissues and conditions

    • GTEx: For tissue-specific expression patterns in humans

    • Animal Genome databases: For bovine-specific expression data

  • Pathway and interaction databases:

    • STRING: For protein-protein interaction networks, as used in analyses of F2RL1 and its 43 overlapping immune-related genes

    • KEGG: For pathway mappings and functional annotations

    • Reactome: For detailed pathway information

    • ImmPort: For immune-related gene annotations, which has been valuable in identifying F2RL1-related immune genes

  • Disease and variation databases:

    • OMIM: For human disease associations

    • COSMIC: For cancer-related somatic mutations

    • Animal QTL Database: For bovine trait loci associations

  • Analysis platforms:

    • XIANTAO: For survival analysis and ROC analysis

    • TIMER2.0: For immune infiltration analysis based on gene expression data

    • R packages: Specialized packages like "Limma" for differential expression analysis, "GSVA" for gene set variation analysis, and "ggplot2" for visualization

These resources enable comprehensive analysis of F2RL1 from sequence to function across species, facilitating comparative studies and translational research.

How can researchers effectively integrate findings from in vitro, in vivo, and clinical studies of F2RL1?

Effective integration of multi-level F2RL1 research requires systematic approaches:

  • Translational research framework:

    • Establish clear hypotheses testable across experimental systems

    • Design parallel experiments in different models using comparable interventions and readouts

    • Validate key findings across multiple systems (e.g., confirm in vitro signaling mechanisms in vivo)

  • Consistent methodology:

    • Standardize F2RL1 activation methods across experimental systems

    • Use equivalent concentrations/doses scaled appropriately for different models

    • Apply consistent analytical approaches to facilitate direct comparisons

  • Bridging studies:

    • Design experiments specifically to connect findings between different systems

    • Use ex vivo approaches (e.g., primary cells derived from in vivo models) as intermediaries

    • Develop humanized animal models expressing human F2RL1 to improve clinical translation

  • Data integration strategies:

    • Meta-analysis of findings across multiple studies and systems

    • Development of computational models incorporating data from multiple sources

    • Creation of shared databases with standardized reporting of F2RL1 experiments

  • Validation in clinical samples:

    • Test hypotheses generated in model systems using patient-derived materials

    • Correlate experimental findings with clinical parameters and outcomes

    • Validate potential biomarkers in appropriate clinical cohorts

Successful examples of this integration include research on cervical cancer, where F2RL1's role was investigated through bioinformatic analyses of TCGA data, experimental validation in patient samples, and correlation with clinical outcomes . Similarly, studies on renal fibrosis have connected in vitro mechanisms of PAR2 signaling with in vivo phenotypes in PAR2-deficient mice .

What are the most promising unexplored aspects of F2RL1 biology that warrant further investigation?

Several promising research directions for F2RL1/PAR2 remain relatively unexplored:

  • Receptor biology:

    • Biased signaling: Different activating proteases or synthetic peptides may preferentially activate distinct signaling pathways downstream of PAR2.

    • Receptor trafficking: The dynamics of PAR2 internalization, recycling, and degradation following activation remain incompletely understood.

    • Heterodimer formation: PAR2 may form functional heterodimers with other GPCRs, altering signaling outcomes.

  • Tissue-specific functions:

    • Microbiome interactions: PAR2's role in sensing intestinal proteases derived from the microbiome represents an emerging area.

    • Nervous system: PAR2's functions in neurons and glial cells are incompletely characterized.

    • Metabolic tissues: PAR2's potential roles in adipose tissue, pancreas, and liver metabolism warrant further study.

  • Disease applications:

    • Fibrosis in other organs: Beyond kidney, PAR2's role in pulmonary, cardiac, and hepatic fibrosis requires investigation.

    • Inflammatory disorders: PAR2's contributions to chronic inflammatory diseases beyond current models.

    • Cancer biology beyond cervical cancer: The striking findings in cervical cancer suggest PAR2 may play important roles in other cancer types.

  • Therapeutic potential:

    • Tissue-specific targeting: Developing approaches to target PAR2 in specific tissues while sparing others.

    • Pathway-selective modulation: Creating biased ligands that activate beneficial signaling while avoiding detrimental pathways.

    • Combination therapies: Identifying synergistic combinations of PAR2 modulators with other therapeutic agents.

  • Comparative biology:

    • Species-specific functions: Investigating unique aspects of bovine PAR2 biology that might inform veterinary medicine or comparative physiology.

    • Evolutionary adaptations: Understanding how PAR2 functions have adapted to different physiological demands across species.

These directions represent opportunities for researchers to make significant contributions to our understanding of F2RL1/PAR2 biology and its therapeutic applications.

How might single-cell technologies advance our understanding of F2RL1 function in heterogeneous tissues?

Single-cell technologies offer transformative opportunities for understanding F2RL1/PAR2 biology in complex tissues:

  • Cell type-specific expression patterns:

    • Single-cell RNA sequencing (scRNA-seq) can reveal the distribution of F2RL1 expression across cell types within heterogeneous tissues like kidney, tumor microenvironment, or inflammatory sites.

    • This approach can identify previously unrecognized F2RL1-expressing cell populations that might contribute to disease pathogenesis.

  • Response heterogeneity:

    • Single-cell technologies can uncover how individual cells within a population respond differently to PAR2 activation.

    • This may reveal subpopulations with distinct signaling responses or thresholds for activation.

  • Cellular interaction networks:

    • Single-cell spatial transcriptomics can map the spatial relationships between F2RL1-expressing cells and other cell types in tissues.

    • This can reveal potential paracrine signaling networks and cellular interactions mediated by PAR2 activation.

  • Trajectory analysis:

    • Single-cell data can be used to reconstruct cellular differentiation or disease progression trajectories.

    • This approach could reveal how F2RL1 expression and signaling change during processes like fibrosis development or cancer progression.

  • Precision medicine applications:

    • Single-cell profiling of patient samples can identify patient-specific patterns of F2RL1 expression and associated signaling networks.

    • This information could guide personalized therapeutic approaches targeting PAR2.

For bovine F2RL1 research, single-cell approaches could be particularly valuable for understanding receptor function in complex tissues like mammary gland during mastitis, or in bovine respiratory or intestinal tissues during inflammatory conditions.

What interdisciplinary approaches might yield breakthrough insights into F2RL1 biology and therapeutic targeting?

Breakthrough advances in F2RL1/PAR2 research may emerge from interdisciplinary collaborations:

  • Structural biology and medicinal chemistry:

    • Cryo-EM structures of PAR2 in different activation states could guide rational drug design.

    • Fragment-based drug discovery approaches may identify novel binding sites for allosteric modulators.

    • Peptide engineering could create tethered ligand mimetics with improved pharmacological properties.

  • Bioengineering and materials science:

    • Development of protease-responsive biomaterials incorporating PAR2 signaling domains.

    • Engineered cell-based systems with synthetic PAR2 signaling circuits for therapeutic applications.

    • Targeted nanoparticle delivery of PAR2 modulators to specific tissues.

  • Systems biology and artificial intelligence:

    • Machine learning models to predict patient responses to PAR2-targeted therapies based on multi-omics profiles.

    • Network analysis algorithms to identify optimal combination therapy targets in PAR2 signaling networks.

    • In silico modeling of PAR2 signaling dynamics across different cell types and conditions.

  • Immunology and microbiome research:

    • Investigation of PAR2's role in mediating host-microbiome interactions in health and disease.

    • Development of PAR2-based strategies to modulate immune responses in autoimmunity or cancer.

    • Understanding how microbiome-derived proteases regulate PAR2 function in different tissues.

  • Comparative biology and evolutionary medicine:

    • Cross-species analyses of PAR2 structure and function to identify fundamental mechanisms and species-specific adaptations.

    • Leveraging natural variations in PAR2 across species to understand receptor evolution and function.

    • Development of veterinary applications based on species-specific PAR2 biology.

These interdisciplinary approaches could transform our understanding of F2RL1/PAR2 biology and lead to innovative therapeutic strategies for targeting this receptor in various diseases.

How has our understanding of F2RL1/PAR2 evolved over the past decade, and what paradigm shifts have occurred?

The past decade has witnessed significant evolution in our understanding of F2RL1/PAR2 biology:

  • From inflammation to fibrosis: Early research focused primarily on PAR2's role in inflammation, but recent studies have revealed its critical involvement in fibrotic diseases. Research has demonstrated that PAR2 deficiency protected against renal fibrosis in mouse models, with PAR2-deficient mice displaying reduced renal tubular injury, fibrosis, collagen synthesis, and profibrotic gene expression .

  • From single pathway to signaling network: The understanding of PAR2 signaling has evolved from a linear G-protein coupled pathway to recognition of a complex signaling network involving transactivation of other receptors. Critical discoveries include PAR2's ability to transactivate both EGFR and TGFβ receptor signaling pathways, leading to Smad2 phosphorylation and profibrotic gene expression .

  • From tissue-specific to systemic relevance: PAR2's importance has expanded from specific tissues to recognition of its systemic relevance across multiple organ systems and diseases. Recent research has uncovered its significant role in cancer, particularly cervical cancer, where it correlates with disease progression and immune infiltration .

  • From basic signaling to clinical biomarker: The translational potential of PAR2 research has grown substantially, with recent studies identifying F2RL1 as a potential biomarker with impressive diagnostic value (AUC = 0.996) for cervical cancer .

  • From isolated focus to integrated understanding: PAR2 research has shifted from studying the receptor in isolation to recognizing its place within complex biological systems. Recent work has integrated PAR2 into immune networks, identifying 43 immune-related genes that overlap with F2RL1-associated genes .

These paradigm shifts reflect the maturation of the field and highlight the increasing clinical relevance of F2RL1/PAR2 research.

What are the key technical and methodological challenges that researchers should anticipate when studying recombinant bovine F2RL1?

Researchers working with recombinant bovine F2RL1 should anticipate several technical challenges:

  • Expression and purification:

    • Obtaining sufficient quantities of properly folded receptor protein

    • Maintaining protein stability during purification processes

    • Ensuring correct post-translational modifications, particularly glycosylation

    • Developing appropriate expression systems that maintain receptor functionality

  • Activation methodologies:

    • Identifying optimal proteases for bovine F2RL1 activation

    • Determining appropriate concentrations and exposure times for proteases

    • Developing species-specific PAR2-activating peptides that mimic the bovine tethered ligand

    • Including appropriate controls such as inactive reverse-sequence peptides and aminopeptidase inhibitors like amastatin to prevent peptide degradation

  • Signaling readouts:

    • Establishing reliable assays for bovine-specific signaling pathways

    • Developing antibodies that recognize bovine phospho-proteins for Western blotting

    • Adapting existing human or rodent signaling assays for bovine systems

    • Monitoring signaling events at appropriate time points (5, 15, 30, and 60 minutes for phosphorylation events; 24 hours for gene expression)

  • Model systems:

    • Limited availability of bovine-specific cell lines and research tools

    • Species differences in signaling components that may affect pathway responses

    • Translating findings between bovine and human systems

    • Developing appropriate in vivo models for bovine F2RL1 research

  • Receptor specificity:

    • Distinguishing PAR2-specific effects from activation of other PAR family members

    • Accounting for potential species differences in protease specificity

    • Separating direct PAR2 signaling from effects due to receptor transactivation

Addressing these challenges requires careful experimental design, appropriate controls, and often the development of new methodologies specific to bovine systems.

What should be the priority research directions for translating basic F2RL1 findings into clinical applications?

To accelerate translation of F2RL1/PAR2 research into clinical applications, researchers should prioritize:

  • Biomarker validation and development:

    • Validate F2RL1 as a diagnostic and prognostic biomarker in larger, diverse patient cohorts

    • Develop standardized assays for measuring F2RL1 in clinical samples

    • Conduct prospective studies to assess the predictive value of F2RL1 expression

    • The promising findings in cervical cancer, where F2RL1 shows early diagnostic potential with expression increases at ASCUS stage and during HPV infection, warrant particular attention

  • Therapeutic target validation:

    • Conduct preclinical studies in relevant disease models to confirm F2RL1's role as a therapeutic target

    • Identify patient populations most likely to benefit from F2RL1-targeted therapies

    • Determine optimal timing for therapeutic intervention in disease progression

    • Studies showing attenuated renal fibrosis in PAR2-deficient mice provide strong rationale for targeting PAR2 in kidney disease

  • Drug development pipeline:

    • Develop potent and selective F2RL1 modulators with favorable pharmacokinetic properties

    • Screen compound libraries against various PAR2 activation modes and readouts

    • Optimize lead compounds for clinical development

    • Consider biased ligands that selectively modulate beneficial signaling pathways

  • Combination therapy strategies:

    • Investigate synergistic combinations of F2RL1 modulators with existing therapies

    • Explore dual inhibition of F2RL1 and transactivated receptors like EGFR or TGFβ receptors

    • For cancer applications, investigate combinations with immunotherapies given F2RL1's relationship with immune infiltration

  • Precision medicine approaches:

    • Develop companion diagnostics to identify patients likely to respond to F2RL1-targeted therapies

    • Stratify patients based on F2RL1 expression levels and associated biomarkers

    • Design clinical trials with biomarker-guided enrollment strategies

    • Consider race-specific approaches, as F2RL1 expression shows differential impacts across racial groups

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.