Recombinant Bovine Proteinase-activated receptor 3 (F2RL2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which customers can use as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a 6-month shelf life at -20°C/-80°C. Lyophilized form has a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
F2RL2; PAR3; Proteinase-activated receptor 3; PAR-3; Coagulation factor II receptor-like 2; Thrombin receptor-like 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-377
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
TFRGAPQNSFEEFPLSAIEGWTGTTKTVKIKCPEELDSNLHVNNATMGYLSSPLSTKLIP AIYILVFAVGMPANAVTLWMLFRTRTIRMTIFYTNLAIADFLFCVTLPFRIAYHLNGNNW VFGEVMCRATTVIFYGNMYCSILLLACISINRYLAIVHPFTYRGLPKRTYALLTCGLVWT TVFLYMLPFFILKQEYYLVQQDITTCHDVHNTCESSSPFQLYYFISLAFFGFLIPFLVII YCYTAIIWTLNAKDRRWLWYIKASLLTFVIFTICFAPSNIILIIHHANYYYSNTDALYFV YLIALCLGSLNSCLDPFLYFLMSKITDHSTAYLTMVKLS
Uniprot No.

Target Background

Function
Receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of bovine PAR3 (F2RL2)?

Bovine Proteinase-activated receptor 3 (PAR3), encoded by the F2RL2 gene, shares significant structural similarities with PAR1 and PAR2 . The F2RL2 gene contains two exons, with the second exon encoding the crucial protease cleavage site . The full-length mature bovine PAR3 protein spans amino acids 39-377, with the canonical thrombin cleavage site occurring at the Lys38/Thr39 position . This cleavage reveals an NH2-terminal sequence of TFRGAP that theoretically could serve as a tethered ligand .

Following cleavage by thrombin, PAR3 remains bound to thrombin's exosite I through its hirudin-like domain, which is rich in aromatic and acidic residues, similar to the binding mechanism observed with PAR1 . Unlike other PARs, bovine PAR3 possesses a relatively short cytoplasmic domain, which may explain its limited direct signaling capacity . The amino acid sequence of recombinant bovine PAR3 includes multiple transmembrane domains and binding sites essential for its interactions with thrombin and potentially other proteases .

How does bovine PAR3 expression differ from other species and other PAR family members?

Bovine PAR3 shares functional similarities with mouse PAR3 but differs significantly from human PAR3 in terms of expression patterns and signaling capabilities . PAR3 transcripts are present in both platelets and endothelial cells, with biased expression observed in fat, stomach, thyroid, and colon tissues . This expression pattern distinguishes it from other PAR family members that may have broader or different tissue distributions .

In mice, PAR3 serves primarily as a cofactor for PAR4 rather than as an independent signaling receptor, a function that appears conserved in bovine PAR3 . In contrast, human platelets express PAR1 and PAR4, both of which independently couple to G proteins and signal efficiently . These species-specific differences in PAR expression and function are critical considerations when designing experiments using bovine PAR3 as a model system for investigating thrombin signaling mechanisms .

What are the recommended storage and handling conditions for recombinant bovine PAR3 protein?

Recombinant bovine PAR3 is typically supplied as a lyophilized powder that requires proper reconstitution and storage to maintain activity . For reconstitution, it is recommended to briefly centrifuge the vial before opening to bring the contents to the bottom, then reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 5-50% (with 50% being standard) helps maintain stability during storage .

For long-term storage, aliquot the reconstituted protein and store at -20°C or -80°C to avoid repeated freeze-thaw cycles, which can degrade protein quality and activity . Working aliquots may be stored at 4°C for up to one week . The protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles . Proper handling of the recombinant protein is essential for ensuring experimental reproducibility and reliable results in functional studies.

How does the cofactoring mechanism of bovine PAR3 function at the molecular level?

The cofactoring mechanism of bovine PAR3 likely mirrors that observed in mouse PAR3 (mPAR3), which has been extensively characterized . At the molecular level, this process involves several coordinated steps. When thrombin encounters PAR3, it cleaves the receptor at the Lys38/Thr39 position . Unlike typical PAR activation, this cleavage does not primarily initiate signaling through PAR3 itself . Instead, the cleaved PAR3 remains bound to thrombin's exosite I through its hirudin-like domain .

This binding arrangement is critical because it leaves thrombin's active site accessible to other substrates while maintaining thrombin in proximity to the cell membrane . X-ray crystallography studies using N-terminal fragments of murine PAR3 and PAR4 bound to thrombin have demonstrated that cleaved mPAR3 remains bound to exosite I of thrombin while leaving the active site free and accessible to PAR4 . This arrangement facilitates PAR4 cleavage by increasing the local concentration of thrombin near PAR4 and potentially altering thrombin's conformation to enhance substrate diffusion into the active site .

In bovine platelets, this cofactoring mechanism likely enables more efficient thrombin-mediated signaling through PAR4 at lower thrombin concentrations than would be possible without PAR3 present . This represents a sophisticated example of receptor cooperation that enhances cellular sensitivity to proteolytic signals.

What experimental approaches can differentiate between PAR3's direct signaling versus cofactoring functions?

Distinguishing between direct signaling and cofactoring functions of bovine PAR3 requires specialized experimental approaches. One effective strategy involves comparing cellular responses in systems expressing PAR3 alone versus those co-expressing PAR3 with PAR4 . In cells expressing only PAR3, thrombin stimulation typically produces minimal signaling responses, while co-expression with PAR4 significantly enhances thrombin-stimulated signaling at the same thrombin concentrations .

To definitively establish cofactoring, researchers should employ mutational analyses targeting specific domains of PAR3. Mutations in the hirudin-like domain that disrupt binding to thrombin's exosite I should impair cofactoring without affecting potential direct signaling . Similarly, truncation of PAR3's C-terminal domain to remove potential G-protein coupling sites can help determine if any observed effects occur through direct signaling or cofactoring mechanisms .

Pharmacological approaches using selective antagonists can also provide valuable insights. For example, bivalirudin, which prevents thrombin exosite I interaction with the hirudin-like domain, can block the cofactoring effect while leaving potential direct signaling intact . Additionally, calcium imaging in cells expressing various PAR combinations can help quantify the signaling enhancement provided by PAR3 cofactoring .

Experimental ApproachPurposeExpected Result if CofactoringExpected Result if Direct Signaling
Expression of PAR3 aloneTest direct signalingMinimal response to thrombinRobust response to thrombin
Co-expression of PAR3 and PAR4Test cofactoringEnhanced PAR4 activation at low thrombinAdditive signaling effects
PAR3 hirudin-like domain mutationsDisrupt exosite I bindingImpaired thrombin sensitivityMaintained direct signaling
PAR3 C-terminal truncationRemove G-protein couplingMaintained cofactoringAbolished direct signaling
Bivalirudin treatmentBlock exosite I interactionsImpaired cofactoringUnaffected direct signaling

What is the significance of PAR3's short cytoplasmic domain for its function?

The short cytoplasmic domain of PAR3 represents a distinctive structural feature that significantly influences its functional properties . Unlike PAR1 and PAR4, which possess longer cytoplasmic tails capable of robust G-protein coupling and downstream signaling, PAR3's abbreviated cytoplasmic region likely limits its capacity for direct signal transduction . This structural characteristic provides strong mechanistic support for PAR3's predominant role as a cofactor rather than an independent signaling receptor.

The truncated cytoplasmic domain may have evolved specifically to optimize PAR3's cofactoring function. By limiting direct signaling capabilities, cells can utilize PAR3 primarily to enhance the sensitivity and efficiency of PAR4 activation without introducing competing signaling pathways . This specialization allows for more precise control of thrombin-mediated cellular responses, particularly in platelets where coordinated activation is essential for appropriate hemostatic function .

From an experimental perspective, researchers investigating bovine PAR3 should consider this structural feature when designing functional assays. Traditional G-protein activation assays may yield minimal results with PAR3 alone, but significant enhancement of such signals should be observable when PAR3 and PAR4 are co-expressed . The short cytoplasmic domain essentially represents a natural experimental control that helps differentiate between direct signaling and cofactoring functions.

What are the key considerations for designing experiments using recombinant bovine PAR3?

When designing experiments with recombinant bovine PAR3 (F2RL2), researchers must account for several critical factors to ensure valid and reproducible results. First, expression system selection is crucial—while the commercial recombinant protein is expressed in E. coli with an N-terminal His tag , mammalian expression systems may provide more physiologically relevant post-translational modifications for functional studies. The choice depends on whether structural or functional analyses are prioritized.

Second, appropriate controls must be implemented to distinguish PAR3-specific effects from background or non-specific interactions. These should include:

  • Cells expressing PAR3 alone versus co-expressed with PAR4

  • Mock-transfected or untransfected cells

  • Cells expressing mutated PAR3 (e.g., cleavage site mutations)

  • Selective antagonists of other PARs to isolate PAR3-specific responses

Third, researchers must carefully consider the concentration range of thrombin or other proteases used for activation. Given PAR3's cofactoring role, lower thrombin concentrations (0.1-1 nM) often reveal cofactoring effects more clearly than higher concentrations that may activate PAR4 directly . The timing of measurements is also critical, as cofactoring may accelerate the kinetics of PAR4 activation rather than simply increasing maximum response.

Experimental ComponentRecommendationRationale
Expression systemMammalian cells for functional studies; E. coli for structural studiesBalance between proper folding/modification and yield
Protease concentrationLow-range (0.1-1 nM thrombin)Better reveals cofactoring effects
Essential controlsPAR3 alone, PAR3+PAR4, cleavage site mutantsDistinguishes direct vs. cofactoring effects
ReadoutsCalcium signaling, phosphorylation cascades, G-protein activationComprehensive assessment of signaling
Time course0-60 seconds (early) and 1-30 minutes (late)Captures both immediate and sustained responses

How can researchers effectively analyze the interaction between recombinant bovine PAR3 and thrombin?

Co-immunoprecipitation studies using antibodies against the His tag of recombinant bovine PAR3 can detect thrombin binding in more complex systems . By combining this approach with Western blotting using anti-thrombin antibodies, researchers can confirm physical interaction between the proteins. For structural insights, X-ray crystallography of PAR3 N-terminal fragments bound to thrombin can reveal the precise molecular interactions at the thrombin exosite I, similar to studies conducted with mouse PAR3 .

To analyze the functional consequences of this interaction, researchers should employ fluorogenic peptide substrates that mimic PAR4's cleavage site . By measuring the rate of substrate cleavage in the presence or absence of recombinant PAR3, the cofactoring effect can be quantified. Additionally, site-directed mutagenesis of key residues in PAR3's hirudin-like domain should correlate with changes in binding affinity and cofactoring efficiency, further elucidating the structural basis of this interaction.

What methods are most effective for analyzing PAR3 expression and localization in bovine tissues?

Analyzing PAR3 expression and localization in bovine tissues requires a combination of molecular, cellular, and imaging techniques. For quantitative expression analysis, quantitative reverse transcription PCR (RT-qPCR) using primers specific to bovine F2RL2 provides precise measurement of mRNA levels across different tissues . This should be complemented by Western blotting using validated antibodies against bovine PAR3 or against the His tag in recombinant protein studies .

For cellular and tissue localization, immunohistochemistry (IHC) and immunofluorescence (IF) are particularly valuable. These techniques can visualize PAR3 distribution in tissue sections or cultured cells, revealing its membrane localization and potential co-localization with other PARs, especially PAR4 . For optimal results, antigen retrieval methods should be optimized for the specific antibodies used, and appropriate blocking of non-specific binding is essential.

MethodApplicationKey Considerations
RT-qPCRQuantitative expression analysisDesign primers specific to bovine F2RL2 to avoid cross-reactivity
Western blottingProtein expression levelsUse recombinant protein as positive control; validate antibody specificity
ImmunohistochemistryTissue localizationOptimize antigen retrieval; include isotype controls
ImmunofluorescenceSubcellular localizationCo-stain with membrane markers and other PARs
Flow cytometrySurface expression quantificationUse non-permeabilized cells for surface-only detection
In situ hybridizationmRNA localizationDesign probes specific to bovine F2RL2 transcript

For higher resolution analysis, confocal microscopy combined with fluorescently labeled antibodies can reveal the precise membrane distribution of PAR3 and potential clustering with PAR4 or other receptors . To differentiate between internal and surface-expressed receptors, non-permeabilized cells should be compared with permeabilized samples. Additionally, flow cytometry using anti-PAR3 antibodies can quantitatively measure surface expression levels in isolated primary cells like bovine platelets or cultured cell lines expressing recombinant bovine PAR3 .

How should researchers interpret inconsistencies between PAR3 expression and thrombin responsiveness?

Inconsistencies between PAR3 expression levels and thrombin responsiveness represent one of the more challenging aspects of PAR3 research. These discrepancies often stem from PAR3's primary function as a cofactor rather than as a direct signaling receptor . When analyzing such data, researchers should first determine whether PAR4 or other thrombin receptors are co-expressed in the system under study . High PAR3 expression with minimal thrombin response may indicate absence of PAR4, while PAR3 expression correlating with enhanced thrombin sensitivity (but not necessarily increased maximum response) suggests successful cofactoring .

Several analytical approaches can help resolve these apparent contradictions:

  • Perform concentration-response curves for thrombin at varying expression levels of PAR3 and PAR4, examining shifts in EC50 values rather than maximum responses .

  • Analyze the kinetics of thrombin response, as PAR3 cofactoring typically accelerates PAR4 activation, resulting in more rapid signal onset even when maximum amplitude remains unchanged .

  • Employ receptor-selective activating peptides alongside thrombin to distinguish direct activation of individual receptors from cofactoring effects .

  • Quantitatively correlate PAR3:PAR4 expression ratios with thrombin sensitivity parameters using regression analysis to identify optimal stoichiometry for cofactoring efficiency .

  • Consider that post-translational modifications or protein-protein interactions may regulate PAR3's cofactoring ability independently of expression level .

When analyzing bovine systems specifically, researchers should remember that unlike human platelets, where PAR1 serves as both a signaling receptor and PAR4 cofactor, bovine PAR3 may function primarily as a cofactor similar to mouse PAR3 . This species-specific difference is crucial for properly interpreting expression-function relationships.

What approaches can resolve contradictory findings regarding PAR3 signaling capacity?

The signaling capacity of PAR3 has been a subject of contradictory findings across different experimental systems . To resolve these contradictions, researchers working with bovine PAR3 should implement a systematic approach that differentiates between direct signaling and cofactoring effects while controlling for experimental variables that might confound interpretation.

A comprehensive experimental strategy should include:

  • Direct comparison of multiple signaling readouts from the same experimental system, including Ca²⁺ mobilization, phosphoinositide hydrolysis, MAPK activation, and G-protein coupling . Bona fide direct signaling would activate multiple downstream pathways, while cofactoring might selectively enhance specific signals mediated by other receptors.

  • Expression of bovine PAR3 in cell lines lacking endogenous PARs to eliminate confounding effects from endogenous receptors . Parallel experiments with human PAR1 or PAR4 as positive controls can establish the sensitivity of the assay system.

  • Utilization of biased agonists or antagonists that selectively interact with specific receptor conformations, potentially revealing signaling capabilities not evident with canonical activators like thrombin .

  • Development of PAR3 chimeric constructs, replacing the short cytoplasmic domain with longer signaling-competent domains from PAR1 or PAR4 to determine if the limited signaling capacity stems from this structural feature .

  • Application of CRISPR-Cas9 gene editing to create precise mutations in endogenous PAR3, avoiding artifacts associated with overexpression systems .

The following data table provides a structured approach to resolving contradictory findings:

Experimental ParameterControl ConditionTest ConditionExpected Outcome if Direct SignalingExpected Outcome if Cofactoring Only
Cell typePAR-null cellsPAR-null + bovine PAR3Thrombin-induced signalingNo thrombin-induced signaling
Receptor expressionPhysiological levelsOverexpressionLinear response increaseMinimal change unless PAR4 present
Receptor mutantsWild-type PAR3PAR3 with mutated tethered ligandAbolished signalingMaintained cofactoring
Signaling pathwaysGq-coupling (Ca²⁺)Multiple G-protein pathwaysActivation of multiple pathwaysLimited to pathways activated by PAR4
Time courseRapid signaling (seconds)Sustained signaling (minutes)Both rapid and sustained componentsOnly kinetic enhancement of PAR4 signals

How can researchers effectively analyze and present PAR3 cofactoring data in publications?

Effective analysis and presentation of PAR3 cofactoring data requires careful attention to both experimental design and data visualization. When preparing results for publication, researchers should organize data to clearly distinguish direct effects from cofactoring while providing comprehensive characterization of the experimental system.

For robust data presentation, consider the following structured approach:

  • System Characterization: Begin by documenting expression levels of recombinant bovine PAR3 and relevant interacting proteins (particularly PAR4) using Western blots, flow cytometry, or qPCR data . Present this as a foundational figure establishing the experimental model.

  • Concentration-Response Relationships: Display thrombin concentration-response curves under multiple conditions (PAR3 alone, PAR4 alone, PAR3+PAR4) using semi-logarithmic plots that highlight shifts in EC50 values . This format clearly illustrates the leftward shift (increased potency) characteristic of successful cofactoring.

  • Kinetic Analysis: Present time-course data comparing the rate of response onset between systems with and without PAR3 . Include curve-fitting analysis that extracts rate constants, as cofactoring typically accelerates activation kinetics.

  • Mechanistic Investigations: Structure data from mutagenesis studies as correlation plots linking structural modifications to functional outcomes . This approach highlights structure-function relationships underlying the cofactoring mechanism.

The following table format effectively summarizes cofactoring effects across multiple experimental conditions:

Experimental ConditionThrombin EC50 (nM)Maximal Response (% control)Response Onset (t1/2, sec)Curve Slope (Hill coefficient)
PAR4 alone10.2 ± 1.310042.5 ± 3.81.1 ± 0.2
PAR3 + PAR4 (1:1)2.4 ± 0.5105 ± 818.3 ± 2.11.3 ± 0.2
PAR3(mutant) + PAR49.8 ± 1.598 ± 740.2 ± 4.51.0 ± 0.2
PAR3 alone>100<10Not determinedNot determined

For statistical analysis, paired comparisons between conditions with and without PAR3 are generally more powerful than unpaired tests . When presenting data in publications, utilize consistent graphical elements (colors, symbols) across figures to facilitate comparison, and clearly indicate which effects are attributed to direct signaling versus cofactoring in figure legends .

What are the most promising applications of recombinant bovine PAR3 in comparative receptor biology?

Recombinant bovine PAR3 offers exceptional opportunities for advancing comparative receptor biology, particularly for understanding evolutionary adaptations in proteolytic signaling mechanisms . One promising application involves systematic comparisons of cofactoring efficiency between bovine PAR3 and its orthologs in other species . Such studies could reveal how subtle sequence variations in the hirudin-like domain or the cleavage site region influence thrombin binding and subsequent PAR4 activation across species .

Beyond thrombin interactions, recombinant bovine PAR3 can serve as a model for investigating noncanonical activation mechanisms by various proteases . While initial studies have focused on thrombin, comprehensive screening against diverse proteases might reveal species-specific sensitivities that correlate with unique physiological challenges faced by different organisms . This comparative approach could identify previously unrecognized protease-receptor pairs with biological significance.

The truncated cytoplasmic domain of PAR3 presents an intriguing model for studying the evolution of biased GPCR signaling . By creating chimeric receptors that combine the extracellular domains of bovine PAR3 with varying cytoplasmic tails from other PARs or GPCRs, researchers could investigate how evolutionary pressures shape signaling specificity and bias . Such studies might reveal fundamental principles applicable to GPCR biology beyond the PAR family, potentially informing drug discovery efforts targeting biased signaling.

How might emerging technologies advance our understanding of bovine PAR3 functions?

Emerging technologies offer unprecedented opportunities to elucidate bovine PAR3 functions with greater precision and physiological relevance. CRISPR-Cas9 gene editing now enables precise modification of endogenous PAR3 in primary bovine cells, avoiding artifacts associated with overexpression systems . By introducing specific mutations or fluorescent tags at the genomic level, researchers can study PAR3 behavior under native regulatory control.

Advanced structural biology techniques, including cryo-electron microscopy and single-particle analysis, could reveal the dynamic conformational changes occurring during PAR3-thrombin-PAR4 ternary complex formation . These approaches might capture intermediate states during cofactoring that explain how PAR3 enhances PAR4 activation at the molecular level .

Novel biosensor technologies based on FRET or BRET could monitor real-time protein-protein interactions between PAR3, thrombin, and PAR4 in living cells . Such sensors might detect subtleties in complex assembly kinetics that correlate with functional outcomes, providing mechanistic insights not achievable with endpoint assays.

Emerging TechnologyApplication to Bovine PAR3 ResearchPotential Insights
CRISPR-Cas9 gene editingEndogenous PAR3 modificationNative regulation and function
Cryo-EMTernary complex structural analysisCofactoring mechanism visualization
FRET/BRET biosensorsReal-time interaction monitoringDynamic assembly kinetics
OrganoidsSpecies-specific tissue modelsPhysiological PAR3 function
Single-cell proteomicsCell-specific PAR3 expression patternsHeterogeneity in cofactoring efficiency
Spatial transcriptomicsTissue distribution of PAR3/PAR4 co-expressionIdentification of cofactoring-dependent tissues

Organoid technologies could provide species-specific tissue models that maintain the native cellular architecture and microenvironment in which bovine PAR3 functions . These three-dimensional cultures might reveal tissue-specific cofactoring effects not evident in conventional cell culture systems, particularly for tissues showing biased PAR3 expression like stomach, thyroid, and colon .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.