Recombinant Bovine Protrudin (ZFYVE27)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ZFYVE27; Protrudin; Zinc finger FYVE domain-containing protein 27
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-404
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MQTSEREGCGPEVSPSTVPEATLESLPVPTKLPAFDLFNLVLSYKRLEVYLEPLKDAGDG VRYLLRWQTPLCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEGCQARLSES ELMRRKYHSVRQEDLQRVRLSRPEAVAEVKSFLIQLEALLSRLCGTCEAAYRVLHWENPA VSSQFYGALLGTVCMLYLLPLCWVLALLNSTLFLGNVEFFRVVSEYRASLQRRMNPKQEE SAFESPPPSDAGGKGALVDCTPAPTPTEDLTPGSVEEAEEAEPDEEFKDAIEEDDEGAPC PAEDELVLQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNYGSCTGCSATFSVLKKRRNCS NCGNIFCSRCCSFKVPRSSMGATAPEAQRETVFVCASCNQTLSK
Uniprot No.

Target Background

Function
Recombinant Bovine Protrudin (ZFYVE27) is a key regulator of RAB11-dependent vesicular trafficking during neurite extension via polarized membrane transport. It promotes axonal elongation and contributes to neuronal cell polarity establishment. It is involved in nerve growth factor-induced neurite formation in a VAPA-dependent manner and contributes to both the formation and stabilization of the tubular endoplasmic reticulum (ER) network. It plays a role in ER morphogenesis by regulating the sheet-to-tubule balance and potentially the density of tubule interconnections. Functioning as an adapter protein, it facilitates the interaction of KIF5A with VAPA, VAPB, SURF4, RAB11A, RAB11B, and RTN3. The ZFYVE27-KIF5A complex contributes to the transport of these proteins in neurons. It can induce the formation of neurite-like membrane protrusions in non-neuronal cells in a KIF5A/B-dependent manner.
Database Links
Subcellular Location
Recycling endosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell projection, growth cone membrane; Multi-pass membrane protein.

Q&A

What is Protrudin (ZFYVE27) and what are its key structural domains?

Protrudin (ZFYVE27) is a protein that contains several transmembrane domains, a Rab11-binding domain (RBD11) in its N-terminal region, and a FYVE domain in its C-terminal end. It also harbors a FFAT motif, a coiled-coil domain, and is spanned by three hydrophobic region (HR) motifs in the central region of the protein . These structural domains are hallmarks of a protein implicated in membrane-cargo trafficking. Specifically, the third hydrophobic region (HR3, amino acids 185-207) is essential for ZFYVE27's self-interaction . The FYVE domain, while containing the conserved cysteine residues to coordinate zinc ion binding, lacks some of the conserved FYVE signature motifs (WXXD, RVC, and R(R/K)HHCR) typically found in other FYVE family proteins .

What cellular functions has ZFYVE27 been implicated in?

ZFYVE27 was originally identified as an interacting partner of spastin, which is most frequently mutated in hereditary spastic paraplegia . Functionally, ZFYVE27:

  • Promotes neurite formation through directional membrane trafficking in neurons

  • Interacts with vesicle-associated membrane protein (VAP-A) in the endoplasmic reticulum

  • Binds to phosphatidylinositol 3-phosphate (PtdIns3P) lipid moiety

  • Regulates endothelial cell protrusion and migration

  • Participates in FAK activation signaling pathways

Overexpression of ZFYVE27 in neuronal and non-neuronal cells induces neurites and protrusions, respectively, from the cell soma. Conversely, downregulation of endogenous ZFYVE27 in PC12 cells by RNA interference results in inhibition of neurite outgrowth even after nerve growth factor induction and causes swelling of cell soma .

What expression systems have been successfully used for recombinant bovine ZFYVE27 production?

Several expression systems have been utilized for recombinant ZFYVE27 production:

Expression SystemTagApplicationsReference
HEK293T cellsMYC/DDKPurified recombinant protein for functional studies
Bacterial expression (E. coli)GST or His6In vitro binding assays
Baculovirus-infected Sf9 cellsVariousSelf-assembly studies, VLP production

For bovine ZFYVE27 specifically, recombinant full-length protein with His-tag has been successfully produced , although detailed methodologies for bovine-specific expression are less documented compared to human and rodent ZFYVE27.

How can I optimize expression of functional recombinant bovine ZFYVE27?

Optimization strategies include:

  • Selection of appropriate expression system: For structural studies requiring proper protein folding and post-translational modifications, mammalian or insect cell systems are preferable over bacterial systems.

  • Codon optimization: Codon usage in the expression system should be considered and optimized for bovine sequences.

  • Expression constructs design: Include appropriate tags (His, GST, or MYC/DDK) based on your downstream applications. For in vitro binding assays, GST or His6 tags have been successfully used .

  • Expression conditions monitoring: For baculovirus expression systems, monitor the kinetics of recombinant protein production by harvesting infected cells at different time points (e.g., every 2 days from 1 to 13 days post-infection) .

  • Purification strategy: For ZFYVE27 expressed in Sf9 cells, ultracentrifugation through a 40% sucrose cushion followed by CsCl density gradient ultracentrifugation has been effective .

How does ZFYVE27 self-interact and what is the functional significance?

ZFYVE27 self-interaction occurs primarily through its third hydrophobic region (HR3, residues 185-207) . This has been demonstrated through:

  • Yeast two-hybrid assays: Direct-Y2H assays confirmed full-length ZFYVE27 interacts with itself, and deletion construct analysis mapped the core interaction region to HR3 .

  • Co-immunoprecipitation: Studies with transient co-transfection of differently tagged ZFYVE27 constructs (c-Myc-ZFYVE27 and E2-ZFYVE27) confirmed self-interaction in mammalian cells .

  • Sucrose gradient centrifugation: Analysis revealed that ZFYVE27 oligomerizes into dimer/tetramer forms .

Functionally, ZFYVE27 oligomerization is critical for its ability to promote neurite extensions. Cells expressing ZFYVE27 ΔHR3 (with deletion of amino acids 185-207) fail to produce protrusions and instead exhibit swelling of cell soma. Moreover, when co-expressed with wild-type ZFYVE27, this mutant exerts a dominant negative effect, preventing formation of protrusions and causing cytoplasmic swelling . This suggests that a functionally active oligomeric form is crucial for ZFYVE27's ability to promote neurite extensions.

What experimental approaches can determine the oligomeric state of recombinant bovine ZFYVE27?

To determine the oligomeric state of recombinant bovine ZFYVE27, researchers can employ:

  • Sucrose gradient centrifugation: As demonstrated in previous studies, this can reveal oligomerization into dimer/tetramer forms .

  • Size exclusion chromatography: To separate oligomeric species based on their hydrodynamic radius.

  • Native PAGE analysis: To visualize different oligomeric states under non-denaturing conditions.

  • Chemical crosslinking: Using crosslinkers like glutaraldehyde or DSS to stabilize protein-protein interactions followed by SDS-PAGE analysis.

  • Analytical ultracentrifugation: For precise determination of sedimentation coefficients and molecular weights of oligomeric species.

For ZFYVE27 specifically, sucrose gradient centrifugation has proven effective in demonstrating its oligomerization into dimer/tetramer forms .

What are the key protein interaction partners of ZFYVE27 and how can these interactions be studied?

Key interaction partners of ZFYVE27 include:

Interaction PartnerFunctionMethod of DetectionReference
SpastinMicrotubule severing proteinCo-IP, Y2H
VAP-AEndoplasmic reticulum proteinCo-IP, in vitro binding assay
Rab11 (GDP-bound form)Membrane trafficking regulatorNot specified in search results
Self (ZFYVE27)OligomerizationY2H, Co-IP, sucrose gradient centrifugation

To study these interactions, researchers can employ:

  • Yeast two-hybrid (Y2H) screening: For identifying novel interaction partners or confirming suspected interactions .

  • Co-immunoprecipitation (Co-IP): To verify interactions in mammalian cells. For example, co-expression of E2-ZFYVE27 WT and c-Myc-ZFYVE27 WT in NIH-3T3 cell line followed by immunoprecipitation with E2-tag antibody and Western blot detection with c-Myc antibody .

  • In vitro binding assays: Using recombinant proteins. For example, mixing recombinant His6-protrudin(207-409) with GST-VAP-A, followed by pulldown with glutathione-Sepharose beads .

  • Co-localization studies: Using fluorescence microscopy to visualize spatial proximity of proteins in cells .

  • FRET or BRET analysis: For studying interactions in living cells with high sensitivity.

How does mutation of the FFAT motif affect ZFYVE27's interaction with VAP-A?

The FFAT (two phenylalanines in an acidic tract) motif in ZFYVE27 mediates binding to vesicle-associated membrane protein-associated protein (VAP). Mutation of this motif significantly impacts ZFYVE27's interaction with VAP-A and its cellular functions:

  • Interaction impairment: Both the interaction between ZFYVE27 and VAP-A as well as the induction of process formation by ZFYVE27 were markedly inhibited by mutation of the FFAT motif .

  • Reciprocal mutations in VAP-A: Mutation of Lys94 and Met96 (equivalent to Lys87 and Met89 of the rat protein) in VAP-A, residues critical for binding to FFAT motif-containing proteins, attenuated (but did not abolish) the interaction between VAP-A and ZFYVE27 .

  • Functional consequences: VAP-A is an important regulator of both the subcellular localization of ZFYVE27 and its ability to stimulate neurite outgrowth. Depletion of VAP-A by RNA interference resulted in mislocalization of ZFYVE27 and inhibition of neurite outgrowth induced by nerve growth factor in rat pheochromocytoma PC12 cells .

These findings suggest that the FFAT motif-mediated interaction with VAP-A is crucial for ZFYVE27's proper localization and function in neurite extension.

What are the key considerations when designing experiments with recombinant bovine ZFYVE27?

When designing experiments with recombinant bovine ZFYVE27, researchers should consider:

  • Research question definition: Clearly define your research question, including molecular biology hypothesis and statistical hypothesis .

  • Expression system selection: Based on your research goals, choose between bacterial, insect, or mammalian expression systems. For functional studies requiring proper folding and post-translational modifications, mammalian or insect cell systems are preferable.

  • Construct design: Consider including appropriate tags (His, GST, or MYC/DDK) and designing deletion mutants to study domain-specific functions.

  • Protein stability: ZFYVE27 is a membrane-associated protein with multiple hydrophobic regions. Ensure proper buffer conditions to maintain stability during purification and storage.

  • Validation methods: Plan for validation of protein expression and function using methods like Western blotting, immunofluorescence, and functional assays.

  • Controls: Include appropriate controls, such as wild-type protein for comparison with mutants, and negative controls for interaction studies.

  • Statistical considerations: Determine sample size, required power, and specificity based on minimally acceptable performance differences between experimental groups .

How should I approach experimental design for studying ZFYVE27's role in neurite extension?

For studying ZFYVE27's role in neurite extension, consider this methodological approach:

  • Cell model selection: PC12 cells or primary hippocampal neurons have been successfully used to study ZFYVE27's role in neurite outgrowth .

  • Experimental groups design:

    • Overexpression of wild-type ZFYVE27

    • Overexpression of mutant forms (e.g., ΔHR3)

    • RNA interference to downregulate endogenous ZFYVE27

    • Appropriate controls (empty vector, non-targeting siRNA)

  • Induction of differentiation: In PC12 cells, use nerve growth factor (NGF) to induce neurite outgrowth.

  • Quantitation of process formation: Count transfected cells with processes whose length is greater than the diameter of the nucleus. Examine multiple (e.g., ten) nonoverlapping photomicrographs of each sample using fluorescence microscopy .

  • Complementation experiments: For RNA interference experiments, rescue the phenotype by co-expressing RNAi-resistant ZFYVE27 constructs.

  • Co-expression studies: Investigate the effect of co-expressing ZFYVE27 with its interaction partners (e.g., VAP-A or spastin).

  • Time-course analysis: Monitor neurite extension over time to capture dynamic changes.

This approach allows for comprehensive analysis of ZFYVE27's function in neurite extension, with appropriate controls and quantitative measurements.

How can I analyze phosphatidylinositol 3-phosphate (PtdIns3P) binding properties of recombinant bovine ZFYVE27?

Despite lacking some conserved FYVE signature motifs, ZFYVE27 binds to PtdIns3P. To analyze this binding property:

  • Liposomal assay using PolyPIPosomes:

    • Prepare PolyPIPosomes containing PtdIns3P

    • Incubate with recombinant ZFYVE27

    • Perform pulldown assays and detect bound ZFYVE27 by Western blotting

    • Include appropriate controls (e.g., endogenous EEA1 as a positive control)

  • Direct binding assay with recombinant protein:

    • Use recombinant ZFYVE27 fragment containing the FYVE domain (e.g., GST-ZFYVE27 300-404)

    • Perform liposomal assay to confirm direct binding

    • This approach rules out the possibility of indirect binding via linker proteins

  • Mutation analysis:

    • Generate point mutations in the FYVE domain

    • Test their effect on PtdIns3P binding

    • Correlate binding defects with functional consequences in cellular assays

  • Structural analysis:

    • Compare the sequence of ZFYVE27's FYVE domain with canonical FYVE domains

    • Identify unique features that might explain its binding properties despite lacking conserved motifs

These approaches will provide insights into the unique PtdIns3P binding properties of ZFYVE27 and their functional significance.

What statistical approaches are recommended for analyzing multiple biomarkers in ZFYVE27 functional studies?

For complex functional studies involving multiple measurements or biomarkers, sophisticated statistical approaches are recommended:

  • Multiple biomarker statistical approach: When analyzing multiple parameters, consider statistical models that can handle multivariate data, such as:

    • K-nearest neighbors (kNN) prediction models

    • Principal component analysis (PCA)

    • Partial least squares discriminant analysis (PLS-DA)

  • Study design considerations:

    • Divide data into training and validation sets (e.g., Group A for model building, Group B for prediction)

    • Ensure independent samples for model building and validation

    • Test different combinations of parameters to identify optimal biomarker combinations

  • Performance evaluation:

    • Calculate true-positive and false-positive rates for each parameter and parameter combination

    • Set threshold for acceptable performance (e.g., 95% true-positive rate as required for screening methods)

    • Evaluate model performance across different time points in time-course experiments

  • Software tools:

    • R environment with appropriate packages (e.g., e1071) for implementing statistical models

    • GraphPad Prism or similar tools for visualization and basic statistical analysis

This approach allows for robust analysis of complex datasets and identification of optimal parameter combinations for studying ZFYVE27 function.

What are common challenges in recombinant ZFYVE27 expression and how can they be addressed?

Researchers often encounter several challenges when working with recombinant ZFYVE27:

ChallengePossible CausesSolutions
Low expression levelsToxicity to host cells, protein instabilityUse inducible expression systems, optimize codon usage, lower incubation temperature
InsolubilityHydrophobic domains, improper foldingUse detergents or solubilizing agents, modify buffer conditions, express soluble domains separately
Lack of self-assembly into VLPsMutations or deletions affecting oligomerizationVerify sequence integrity, optimize expression conditions, alter experimental parameters (virus titers, incubation time, cell type)
Protein degradationProtease activity, instabilityInclude protease inhibitors in purification buffers, optimize storage conditions, aliquot protein to avoid freeze-thaw cycles
Loss of functionImproper folding, loss of post-translational modificationsUse mammalian expression systems for functional studies, validate function with appropriate assays

As seen with rJNCV (a recombinant with a truncated capsid protein), sequence analysis identified a single nucleotide deletion that introduced a stop codon, preventing self-assembly into VLPs. This highlights the importance of sequence verification when troubleshooting expression issues .

How can I validate the functionality of my recombinant bovine ZFYVE27?

To ensure your recombinant bovine ZFYVE27 is functionally active, consider these validation approaches:

  • Self-interaction assay: Since oligomerization is crucial for ZFYVE27 function, verify oligomerization using:

    • Co-immunoprecipitation with differently tagged versions

    • Sucrose gradient centrifugation to detect dimer/tetramer forms

  • PtdIns3P binding assay: Confirm lipid binding using liposomal assays with PolyPIPosomes containing PtdIns3P .

  • Protein-protein interaction verification: Test interaction with known partners like spastin or VAP-A using:

    • Co-immunoprecipitation

    • In vitro binding assays

    • Yeast two-hybrid assays

  • Cellular localization: Transfect cells with your recombinant ZFYVE27 and verify proper subcellular localization using immunofluorescence microscopy .

  • Neurite extension assay: The gold standard functional assay for ZFYVE27 is its ability to promote neurite extension in appropriate cell models (PC12 cells or neurons) .

  • Complementation assay: Rescue ZFYVE27 knockdown phenotypes by expressing your recombinant protein, demonstrating functional equivalence to endogenous protein.

These complementary approaches provide comprehensive validation of recombinant ZFYVE27 functionality.

What are emerging applications of recombinant bovine ZFYVE27 in neurodegenerative disease research?

Emerging applications include:

  • Hereditary Spastic Paraplegia (HSP) models: ZFYVE27 (also known as SPG33) has been associated with HSP. Recombinant bovine ZFYVE27 can be used to:

    • Study species-specific differences in ZFYVE27 function

    • Develop in vitro models of HSP

    • Screen for compounds that restore function of mutant ZFYVE27

  • Neurite extension and axonal regeneration: Given ZFYVE27's role in promoting neurite extension, recombinant protein could be explored for:

    • Enhancing axonal regeneration after injury

    • Development of bioscaffolds incorporating functional ZFYVE27

    • Studying mechanisms of neuronal development and regeneration

  • Membrane trafficking in neurodegeneration: As ZFYVE27 functions in directional membrane trafficking, it could be used to:

    • Study impaired membrane trafficking in neurodegenerative diseases

    • Investigate interactions with other proteins implicated in neurodegeneration

    • Develop assays for drug screening targeting membrane trafficking pathways

  • Comparative studies with human ZFYVE27: Bovine ZFYVE27 can serve as a model for understanding human ZFYVE27 function, potentially revealing conserved mechanisms and novel therapeutic targets.

How can CRISPR/Cas9 technology be applied to study bovine ZFYVE27 function?

CRISPR/Cas9 technology offers powerful approaches to study bovine ZFYVE27:

  • Gene knockout studies: Complete deletion of ZFYVE27 in bovine cell lines to assess:

    • Effects on neurite extension and cell morphology

    • Changes in membrane trafficking pathways

    • Alterations in interactions with binding partners

    • Similar approaches have been applied in human cells (e.g., MDA-MB-231)

  • Domain-specific mutations: Introduction of precise mutations to:

    • Disrupt specific domains (HR3, FYVE, RBD11)

    • Create disease-associated mutations

    • Generate tagged versions for live-cell imaging

  • Knock-in approaches: Introduction of fluorescent tags or affinity tags to:

    • Visualize endogenous ZFYVE27 localization and dynamics

    • Facilitate pulldown of endogenous protein complexes

    • Study tissue-specific expression patterns

  • Conditional knockout systems: Using inducible CRISPR systems to:

    • Study temporal aspects of ZFYVE27 function

    • Avoid compensatory mechanisms associated with constitutive knockouts

    • Assess acute vs. chronic effects of ZFYVE27 depletion

  • High-throughput screening: Combining CRISPR libraries with phenotypic screens to:

    • Identify genetic interactors of ZFYVE27

    • Discover pathways that modify ZFYVE27 function

    • Find potential therapeutic targets for ZFYVE27-associated diseases

These approaches would significantly advance our understanding of bovine ZFYVE27 function and its relevance to human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.