Recombinant Bovine Receptor expression-enhancing protein 2 (REEP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
REEP2; Receptor expression-enhancing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
REEP2
Target Protein Sequence
MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLS WFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMR VGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDLTLIRDEDALPLQGPDGRLRASPGS LLDTIEDLGDDPTLSVRSGTNQADPRTEISEDDTGDKAPKRVKPIKKVPKPEPPASKTLK TRPKKKTSAGGDSA
Uniprot No.

Target Background

Function
REEP2 is essential for endoplasmic reticulum (ER) network formation, shaping, and remodeling. It may also enhance the cell surface expression of odorant receptors.
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Receptor Expression-Enhancing Protein 2 (REEP2) and what are its primary cellular functions?

REEP2 is an integral membrane protein that belongs to the REEP/DP1/Yop1p family of proteins involved in shaping the endoplasmic reticulum (ER) . Unlike other accessory proteins that enhance receptor function by promoting transit to the cell surface, REEP2 operates through spatial reorganization of receptors. Specifically, REEP2 physically associates with both subunits of the type 1 taste receptor 2 and type 1 taste receptor 3 sweet receptor and recruits them into lipid raft microdomains localized near the taste cell's apical region . This strategic positioning serves two critical purposes:

  • It improves G-protein-coupled receptor signaling efficiency

  • It promotes receptor access to tastants arriving through the apical taste pore

Research has demonstrated that downregulation of endogenously expressed REEP2 in chemosensory enteroendocrine GLUTag cells dramatically reduces sensitivity of endogenous sweet receptors, confirming its physiological relevance .

Beyond taste function, REEP2 plays crucial roles in neurological health, as mutations in the REEP2 gene have been associated with hereditary spastic paraplegias (HSPs) . The discovery of REEP2's involvement in both sensory and neurological functions makes it an important target for multidisciplinary research.

How does recombinant bovine REEP2 differ structurally and functionally from human REEP2?

While the search results don't specifically address the differences between bovine and human REEP2, comparative analysis can be inferred from related research. REEP2 contains highly conserved regions across species, particularly in the N-terminal domain where disease-associated mutations (p.Val36Glu and p.Phe72Tyr) affect conserved residues . These amino acids are conserved not only across species but also among paralogous members of the REEP family (REEP1, REEP3, and REEP4), suggesting evolutionary preservation of critical functional domains .

In recombinant protein expression systems, species-specific differences often manifest in post-translational modifications and optimal expression conditions. As with other recombinant bovine proteins, maintaining proper folding and native conformation is essential for preserving functional properties of bovine REEP2.

What expression systems are most effective for producing functional recombinant bovine REEP2?

For the expression of recombinant bovine REEP2, mammalian cell expression systems have demonstrated superior results due to their ability to properly fold proteins and perform appropriate post-translational modifications.

Based on research with similar bovine proteins, the following systems are recommended:

HEK-293 Cell Line System:
The human embryonic kidney 293 (HEK-293) cell line has been successfully used for stable expression of recombinant bovine proteins such as bovine interleukin-2 (boIL-2) . Key advantages include:

  • Maintenance of native post-translational modifications, particularly O-glycosylation

  • Compatibility with the piggyBac transposon system for stable expression

  • Achievable protein concentrations of 100-330 ng/ml in culture supernatants

  • Expression stability over multiple passages (>24)

Chinese Hamster Ovary (CHO) Cell Line:
CHO cells represent another excellent option for recombinant bovine protein expression . Optimization strategies include:

  • Vector enhancement with regulatory elements (Kozak and Leader sequences) upstream of the target gene

  • Cell line modification through knockout of apoptotic genes (e.g., Apaf1) using CRISPR/Cas9 technology

Expression SystemAdvantagesExpression LevelsStabilityBest Applications
HEK-293Native post-translational modifications100-330 ng/ml>24 passagesInitial characterization, functional studies
CHOScalability, industrial applicationsVariable (enhanced with optimized vectors)Long-term with selectionLarge-scale production, structural studies

What optimization strategies improve yield and functionality of recombinant bovine REEP2?

Several targeted optimization approaches can significantly enhance both yield and functionality of recombinant bovine REEP2:

Vector Optimization:

  • Incorporation of regulatory elements such as Kozak and Leader sequences upstream of the target gene significantly increases expression levels

  • Selection of appropriate promoters (CMV for strong expression)

  • Inclusion of selection markers (puromycin resistance) and reporter genes (GFP) for monitoring expression

Cell Line Modification:

  • Knockout of apoptotic gene Apaf1 using CRISPR/Cas9 technology has been shown to increase recombinant protein production significantly

  • This approach addresses a key limitation in CHO cell expression systems by inhibiting the mitochondrial apoptosis pathway

Expression Protocol Refinements:

  • Apply selection pressure (e.g., puromycin at 3 μg/ml) starting 2 days after transfection

  • Monitor expression over time to determine optimal harvest point (typically day 7-9 for bovine proteins)

  • Maintain proper cell density and culture conditions

When these optimization strategies are combined, expression levels of recombinant proteins can be "remarkably improved" compared to conventional approaches .

How can researchers effectively characterize the membrane-binding properties of recombinant bovine REEP2?

Characterizing the membrane-binding properties of recombinant bovine REEP2 requires multiple complementary approaches:

Subcellular Localization Analysis:

  • Express V5-tagged REEP2 in COS7 cells to visualize its dot-like distribution pattern along both the ER and microtubules

  • Perform co-localization studies with established ER and membrane markers

  • Use confocal microscopy to determine spatial distribution in polarized cells

Mutational Analysis:

  • Compare wild-type REEP2 with disease-associated mutants (p.Val36Glu and p.Phe72Tyr) that affect membrane binding

  • The p.Val36Glu variant exhibits a dominant-negative effect, inhibiting normal binding of wild-type REEP2 to membranes

  • The p.Phe72Tyr variant decreases membrane affinity

Biochemical Fractionation:

  • Perform membrane fractionation to quantify the proportion of REEP2 associated with different cellular compartments

  • Isolate lipid rafts to determine REEP2's role in organizing these microdomains

  • Compare fractionation profiles between wild-type and mutant REEP2

ER Morphology Assessment:

  • Analyze ER structure in cells expressing recombinant REEP2 versus controls

  • Quantify alterations in ER morphology induced by wild-type versus mutant REEP2

Functional Consequences:

  • Measure the impact of REEP2 membrane binding on receptor function

  • Evaluate how disruptions in membrane binding affect taste receptor sensitivity and signaling

What methods are most reliable for measuring interactions between REEP2 and taste receptors?

To reliably measure interactions between REEP2 and taste receptors, researchers should employ multiple complementary techniques:

Co-immunoprecipitation:

  • Use anti-REEP2 antibodies to pull down protein complexes and probe for taste receptor subunits

  • Verify physical association between REEP2 and both subunits of the type 1 taste receptor 2 and type 1 taste receptor 3 sweet receptor

  • Perform reciprocal experiments using antibodies against taste receptor subunits

Proximity-Based Assays:

  • Employ fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) to measure protein-protein interactions in living cells

  • These approaches provide spatial information about the interaction in intact cellular environments

Membrane Microdomain Analysis:

  • Isolate lipid raft fractions using detergent-resistant membrane preparations

  • Quantify co-segregation of REEP2 and taste receptors into these specialized membrane domains

  • Disrupt lipid rafts (e.g., with methyl-β-cyclodextrin) to assess the dependence of interactions on membrane microdomain integrity

Functional Interaction Assays:

  • Measure receptor responses to tastants using calcium imaging or electrophysiology

  • Compare dose-response curves with and without REEP2 co-expression

  • Determine how REEP2 mutations affect functional enhancement of taste receptors

Visualization Techniques:

  • Use super-resolution microscopy to visualize co-localization at nanoscale resolution

  • Focus particularly on the apical region where REEP2 recruits taste receptors

How does REEP2's role in lipid raft organization differ from other REEP family members?

REEP2 demonstrates a unique mechanism for enhancing receptor function compared to other REEP family members:

Distinctive Mechanism:
While RTP1, RTP2, and REEP1 enhance olfactory receptor function by promoting their transit to the cell surface, REEP2 operates through a fundamentally different mechanism . REEP2 does not increase the cell surface expression of sweet receptors but instead alters their spatial organization within the membrane .

Lipid Raft Recruitment:
REEP2 specifically recruits sweet receptors into lipid raft microdomains localized near the taste cell's apical region . This strategic positioning:

  • Improves G-protein-coupled receptor signaling

  • Promotes receptor access to tastants arriving through the apical taste pore

Structural Determinants:
The N-terminal domain of REEP2 appears critical for its ER-shaping and membrane organization properties. Mutations in this region (p.Val36Glu and p.Phe72Tyr) disrupt membrane binding and are associated with hereditary spastic paraplegias .

Microtubule Interaction:
Unlike some REEP family members, REEP2 rarely induces the formation of microtubule bundles (less than 2% of cells) . This suggests differences in how REEP2 interacts with the cytoskeleton compared to other family members.

These distinctions highlight REEP2's specialized role in organizing membrane microdomains for optimal receptor function, particularly in sensory contexts.

What experimental approaches best elucidate the molecular mechanisms underlying REEP2-associated hereditary spastic paraplegias?

Investigating the molecular mechanisms of REEP2-associated hereditary spastic paraplegias (HSPs) requires multifaceted experimental approaches:

Genetic Analysis:

  • Compare dominant (p.Val36Glu) versus recessive (p.Phe72Tyr with splice site mutation) inheritance patterns

  • Characterize how different mutations lead to distinct disease mechanisms:

    • Dominant-negative effects: p.Val36Glu inhibits normal binding of wild-type REEP2 to membranes

    • Loss-of-function: p.Phe72Tyr decreases membrane affinity, combined with splice mutation causes complete loss of function

Cellular Pathology:

  • Analyze ER morphology in patient-derived fibroblasts

  • Compare structural alterations between different mutation types

  • Develop iPSC-derived neuronal models to study cell type-specific effects

Functional Consequences:

  • Measure membrane binding properties of wild-type versus mutant REEP2

  • Assess impact on ER-shaping abilities

  • Evaluate effects on protein trafficking and cellular stress responses

Rescue Experiments:

  • Attempt phenotypic rescue with wild-type REEP2 in patient-derived cells

  • Test structure-based therapeutic approaches targeting specific mutation mechanisms

Animal Models:

  • Develop knockin mouse models with specific REEP2 mutations

  • Evaluate behavioral, electrophysiological, and structural phenotypes

  • Test therapeutic interventions in vivo

This comprehensive approach connects genetic variants to specific biochemical defects and ultimately to clinical manifestations, providing a foundation for targeted therapeutic development.

What are the primary challenges in maintaining native conformation of recombinant bovine REEP2?

Maintaining the native conformation of recombinant bovine REEP2 presents several technical challenges:

Membrane Protein Stabilization:
REEP2 is an integral membrane protein that shapes the endoplasmic reticulum . Preserving its proper folding and membrane interaction properties outside their native environment is inherently difficult.

Post-Translational Modifications:
As with other mammalian proteins, proper post-translational modifications are essential for maintaining native conformation and function. Expression systems must preserve O-glycosylation and other modifications .

Expression System Selection:
Heterologously expressed sensory receptors generally do not achieve the ligand sensitivity observed in vivo without specific accessory proteins . Similarly, REEP2 itself may require proper cellular context to maintain native structure.

Solutions:

  • Utilize mammalian expression systems (HEK-293, CHO) that better preserve native post-translational modifications

  • Optimize vector design with regulatory elements such as Kozak and Leader sequences

  • Employ the piggyBac transposon system for stable expression

  • Consider co-expression with interacting partners to promote proper folding

  • Validate protein conformation through functional assays rather than relying solely on structural analysis

How can researchers effectively measure REEP2's effect on taste receptor sensitivity?

Measuring REEP2's enhancement of taste receptor sensitivity requires sophisticated methodological approaches:

Cell-Based Functional Assays:

  • Co-express REEP2 with taste receptor subunits in heterologous systems

  • Measure calcium responses to tastants at varying concentrations

  • Generate dose-response curves with and without REEP2 co-expression

  • Compare EC50 values to quantify sensitivity enhancement

RNA Interference Approaches:

  • Downregulate endogenously expressed REEP2 in chemosensory cell lines (e.g., GLUTag)

  • Measure resulting changes in sweet receptor sensitivity

  • This approach has demonstrated dramatic reductions in endogenous sweet receptor sensitivity when REEP2 is downregulated

Receptor Localization Analysis:

  • Quantify receptor recruitment to lipid raft microdomains

  • Assess spatial organization relative to the apical region of taste cells

  • Correlate receptor localization with functional sensitivity

Electrophysiological Recordings:

  • Perform patch-clamp recordings from cells expressing taste receptors

  • Compare response kinetics and magnitude with and without REEP2

  • Correlate electrophysiological parameters with taste sensitivity

MethodologyMeasurementAdvantageLimitation
Calcium imagingReceptor activationReal-time kineticsIndirect measure
RNA interferenceEndogenous functionPhysiological relevancePotential off-target effects
Lipid raft analysisReceptor organizationMechanism insightTechnical complexity
ElectrophysiologyCellular responseDirect measurementLow throughput

What emerging technologies might enhance our understanding of REEP2 function in taste perception?

Several cutting-edge technologies hold promise for advancing our understanding of REEP2's role in taste perception:

Single-Cell Transcriptomics:

  • Profile taste receptor cells at single-cell resolution to correlate REEP2 expression with specific taste modalities

  • Identify co-expression patterns with taste receptors and signaling components

  • Map cell type-specific expression patterns across taste fields

CRISPR-Based Functional Genomics:

  • Generate precise REEP2 mutations or deletions in relevant cell types

  • Create conditional knockout models to study temporal aspects of REEP2 function

  • Employ CRISPR activation/inhibition systems to modulate REEP2 expression levels

Advanced Imaging Technologies:

  • Apply super-resolution microscopy to visualize REEP2-mediated receptor organization at nanoscale resolution

  • Use lattice light-sheet microscopy for dynamic visualization of membrane reorganization

  • Employ correlative light and electron microscopy to link functional imaging with ultrastructural analysis

Cryo-Electron Microscopy:

  • Determine the structure of REEP2 in complex with taste receptor components

  • Visualize REEP2-induced membrane curvature at molecular resolution

  • Compare structures of wild-type versus mutant REEP2 proteins

Organoid and Tissue Engineering:

  • Develop taste bud organoids expressing fluorescent REEP2 and taste receptor markers

  • Create bioengineered taste tissues to study REEP2 function in multicellular contexts

  • Test modulation of taste perception through REEP2 manipulation

How might REEP2 research inform therapeutic approaches for taste disorders and hereditary spastic paraplegias?

Research on REEP2 has significant potential to inform novel therapeutic strategies for both taste disorders and hereditary spastic paraplegias (HSPs):

For Taste Disorders:

  • Receptor Enhancement Strategies:

    • Development of small molecules that mimic REEP2's ability to recruit taste receptors to lipid rafts

    • Design of peptide mimetics that promote taste receptor organization in optimal signaling domains

    • Gene therapy approaches to increase REEP2 expression in taste cells with diminished sensitivity

  • Diagnostic Applications:

    • REEP2 expression profiling as a biomarker for specific taste disorders

    • Correlation of REEP2 variants with taste perception phenotypes

    • Development of functional assays to measure REEP2-mediated taste enhancement

For Hereditary Spastic Paraplegias:

  • Mutation-Specific Approaches:

    • For dominant-negative mutations (p.Val36Glu): development of strategies to selectively silence mutant alleles

    • For recessive loss-of-function mutations: gene replacement or enhancement of remaining protein function

  • ER-Targeting Therapies:

    • Small molecules that stabilize ER morphology in the absence of functional REEP2

    • Compounds that modulate ER stress responses in affected neurons

    • Enhancement of compensatory mechanisms involving other REEP family members

  • Mechanistic Insights:

    • Understanding how different inheritance patterns (dominant vs. recessive) arise from specific mutation effects

    • Identification of critical cellular pathways downstream of REEP2 dysfunction

    • Development of biomarkers for disease progression and therapeutic response

By connecting REEP2's dual roles in taste perception and neurological function, research may uncover unexpected therapeutic avenues applicable to both sensory and neurological disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.