Recombinant Bovine Receptor expression-enhancing protein 5 (REEP5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
REEP5; Receptor expression-enhancing protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MSAAMRQRFDQFLHQKNCMTDLLAKTEAKTGVNRSFIALGVIGLLALYLVFGYGASLLCN LIGFGYPAYVSIKAIESPNKEDDTQWLTYWVVYGVFSIVEFFSDLFLSWFPFYYMLKCGF LLWCMAPSPANGADLLYKRIIRPFFLKHESQVDNVVNDLKDKAKETADTISKEARKAAVS LLGEEKKST
Uniprot No.

Target Background

Function
May enhance cell surface expression of odorant receptors.
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Q&A

What is the basic structure and topology of bovine REEP5?

REEP5 consists of four hydrophobic, hairpin transmembrane domains connected by a hydrophilic segment with both the N- and C-termini facing the cytosol. Multiple prediction algorithms have determined that the N-terminus is cytosolic for REEP5, with predictions showing either 2 or 4 transmembrane helices . This topology has been experimentally confirmed using membrane yeast two-hybrid (MYTH) systems, where N-terminally tagged TF-Cub-REEP5 interacted with Ost1p-NubI but not with Ost1p-NubG, validating that the N-terminus of REEP5 resides in the cytosol . The C-terminal domain of REEP5 has been identified as particularly important for SR integrity .

How is REEP5 expression regulated in different tissues and disease states?

REEP5 shows tissue-specific expression patterns, with notably higher expression in adult ventricular myocardium compared to other REEP family members . In disease conditions, REEP5 expression is dynamically regulated. In the 4-week transverse aortic constriction (TAC) mouse model of heart failure, REEP5 levels are markedly increased. Conversely, in the left anterior descending (LAD) coronary artery ligation myocardial infarction model, REEP5 protein levels are decreased . In human cardiac samples, REEP5 is elevated in idiopathic cardiomyopathy but downregulated in ischemic cardiomyopathy . This differential regulation suggests tissue-specific and condition-dependent control mechanisms that warrant further investigation for therapeutic targeting.

What are the primary functions of REEP5 at the cellular level?

REEP5 serves as a critical modulator of SR/ER membrane architecture and is essential for maintaining proper sarco-endoplasmic reticulum structure and function. Its primary cellular functions include:

  • Shaping high-curvature ER tubules and maintaining SR membrane integrity

  • Supporting proper calcium handling in cardiomyocytes

  • Maintaining excitation-contraction coupling in cardiac tissue

  • Protecting against ER stress and cellular oxidative damage

When REEP5 is depleted in cardiac myocytes, significant SR/ER membrane destabilization and luminal vacuolization occur, accompanied by decreased myocyte contractility and disrupted calcium cycling . These findings establish REEP5 as a central regulator of SR/ER organization and cellular stress responses.

What expression systems are most effective for producing recombinant bovine REEP5?

For recombinant bovine REEP5 production, several expression systems can be employed depending on research needs:

Expression SystemAdvantagesLimitationsYieldApplications
E. coliCost-effective, rapid growthPotential improper folding of membrane proteinsModerateStructural studies, antibody production
Insect cellsBetter for membrane proteins, closer to mammalian foldingMore expensive, longer production timeHighFunctional studies, protein-protein interactions
Mammalian cellsNative-like folding and post-translational modificationsMost expensive, complex protocolsLowerFunctional studies requiring authentic modifications
Cell-free systemsAvoids toxicity issues, direct access to reactionExpensive reagents, optimization requiredVariableDifficult-to-express constructs

For bovine REEP5, mammalian or insect cell expression systems are generally preferred due to the protein's multiple transmembrane domains, which require proper membrane insertion machinery for correct folding and function. When developing expression constructs, careful consideration should be given to purification tags that minimize interference with transmembrane domain insertion.

What are the optimal purification strategies for maintaining REEP5 structural integrity?

Purifying membrane proteins like REEP5 requires specialized approaches:

  • Membrane Extraction: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin for initial solubilization to preserve native conformation.

  • Affinity Chromatography: Employ N-terminal tags (His, FLAG) rather than C-terminal tags, as the C-terminal domain contributes significantly to SR integrity .

  • Lipid Supplementation: Adding phospholipids (particularly phosphatidylcholine) during purification helps stabilize the transmembrane domains.

  • Detergent Exchange: Consider exchanging harsh detergents for milder ones or lipid nanodiscs for downstream applications requiring native-like membrane environments.

The purification strategy should be tailored based on intended applications, balancing yield with structural and functional preservation.

How can researchers verify the functional integrity of purified recombinant REEP5?

Multiple complementary approaches should be used to verify REEP5 functionality:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Size-exclusion chromatography to verify monodispersity

    • Limited proteolysis to assess proper folding

  • Membrane Incorporation Assays:

    • Liposome reconstitution followed by flotation assays

    • Microscopy-based verification of membrane localization in cellular systems

  • Functional Verification:

    • Membrane tubulation assays using artificial liposomes

    • Co-immunoprecipitation with known REEP5 interacting partners

    • ER morphology rescue experiments in REEP5-depleted cells

When validating recombinant REEP5 function, it's critical to include positive controls (native protein extracts) and negative controls (denatured protein) to establish benchmarks for functional activity.

How does REEP5 contribute to SR/ER morphology at the molecular level?

REEP5 shapes SR/ER membranes through multiple molecular mechanisms:

  • Membrane Curvature Generation: REEP5 contains hydrophobic hairpin insertions that penetrate the cytosolic leaflet of the membrane bilayer, inducing and stabilizing membrane curvature necessary for tubular ER formation.

  • Cytoskeletal Interactions: The cytosolic domains of REEP5 likely interact with microtubules to stabilize ER tubules along the cytoskeleton network.

  • Oligomerization Properties: REEP5 forms homo-oligomeric complexes that create scaffolding structures along curved ER membranes.

Focused ion beam scanning electron microscopy-based 3-dimensional reconstruction has revealed that targeted inactivation of REEP5 in rats specifically deforms the cardiac SR membrane without affecting transverse tubules . This precise impact on SR morphology suggests that REEP5 has specialized functions in cardiomyocytes compared to other cell types. In REEP5-depleted adult cardiac myocytes, transmission electron microscopy shows significant disruption of SR integrity, with deformed SR membranes and apparent vacuoles, along with deformed cardiac t-tubules .

What are the molecular mechanisms by which REEP5 depletion impacts calcium handling in cardiomyocytes?

REEP5 depletion affects calcium handling through several interconnected mechanisms:

  • SR/ER Structural Disruption: REEP5 knockdown causes pronounced vacuolization and disorganization of the SR/ER, compromising the structural integrity necessary for calcium storage and release .

  • Altered Calcium Release Dynamics: Simultaneous recordings of depolarization-induced Ca²⁺ currents and Ca²⁺ transients in REEP5-null cardiomyocytes reveal normal L-type Ca²⁺ channel currents but depressed SR Ca²⁺ release .

  • Excitation-Contraction Coupling Defects: The impaired SR structure caused by REEP5 deficiency leads to compromised excitation-contraction coupling gain in cardiomyocytes and reduced cardiac contractility .

  • Functional Consequences: Optical imaging edge analysis of REEP5-depleted adult cardiac myocytes shows significant impairment in fractional shortening (0.3 ± 0.1% compared to 12.4 ± 1.2% in control myocytes), indicating severe functional impairment .

Importantly, these effects occur without altering the expression of major proteins involved in Ca²⁺ handling in the heart, suggesting the primary mechanism is through structural organization rather than expression-level changes .

What protein-protein interactions are critical for REEP5 function in the SR/ER?

REEP5 engages in several key protein-protein interactions that are essential for its function:

  • Self-association: REEP5 forms homo-oligomeric structures that contribute to membrane curvature and tubulation.

  • ER-shaping Protein Network: REEP5 is part of a larger network of proteins involved in ER morphology, including reticulons, atlastins, and lunapark proteins. The coordinated action of these proteins maintains the characteristic tubular structure of the ER network.

  • Cytoskeletal Interactions: The C-terminal region of REEP5 mediates interactions with microtubules, which helps position and stabilize ER tubules.

  • Calcium Handling Machinery: REEP5 likely forms functional complexes with key SR proteins involved in calcium storage and release, such as ryanodine receptors (RyR2), as evidenced by colocalization in immunostaining experiments .

Perturbation of these interactions through REEP5 depletion results in dramatic SR vacuolization as shown by REEP5 and RyR2 immunostaining, with three-dimensional reconstruction revealing vacuolated SR in REEP5-depleted myocytes as opposed to the striated, interconnected SR network in control myocytes .

How can REEP5 knockdown or overexpression models be effectively developed for cardiac research?

Several approaches have proven effective for modulating REEP5 expression in cardiac research models:

  • Lentiviral REEP5-shRNA for in vitro knockdown:

    • Achieves ~60% knockdown after 48 hours post-transduction

    • Reaches ~70% knockdown following 96 hours

    • Allows temporal analysis of REEP5 depletion effects

  • CRISPR/Cas9 gene editing for in vivo models:

    • CRISPR/Cas9-mediated REEP5 loss-of-function zebrafish mutants show sensitized cardiac dysfunction upon short-term verapamil treatment

    • Provides a vertebrate model for studying developmental aspects

  • Adeno-associated viral (AAV9) delivery for cardiac-specific manipulation:

    • In vivo AAV9-induced REEP5 depletion in mice demonstrates cardiac dysfunction

    • Allows tissue-specific targeting with temporal control

  • Transgenic overexpression models:

    • Can be used to assess potential protective effects against cardiac stress conditions

    • Useful for determining whether REEP5 upregulation can ameliorate cardiac pathologies

When developing these models, researchers should include appropriate controls and validate knockdown/overexpression efficiency through both mRNA and protein-level analyses. Time-course studies are particularly valuable as they can distinguish between acute and chronic effects of REEP5 modulation.

What disease models are most relevant for studying REEP5 dysfunction in cardiac pathology?

Based on current research, several disease models are particularly relevant for studying REEP5's role in cardiac pathology:

Disease ModelREEP5 Expression PatternKey FindingsResearch Applications
4-week TAC heart failureIncreased REEP5 levelsCompensatory upregulationAdaptive responses to pressure overload
LAD ligation MI modelDecreased REEP5 levelsAssociated with increased BNPIschemic injury and repair mechanisms
PLN R9C mutant DCMDecreased REEP5 levelsModest BNP increaseDilated cardiomyopathy pathophysiology
Idiopathic cardiomyopathyElevated REEP5 levelsIncreased MHC-β expressionNon-ischemic heart failure mechanisms
Ischemic cardiomyopathyDownregulated REEP5Consistent with GEO dataIschemia-driven cardiac remodeling

These models demonstrate that REEP5 expression is dynamically regulated in different types of cardiac stress and failure, suggesting context-specific roles in disease progression . The decreased expression in ischemic conditions versus increased expression in pressure overload points to distinct regulatory mechanisms worth exploring therapeutically.

How can recombinant REEP5 be utilized to investigate SR/ER stress responses?

Recombinant REEP5 provides a valuable tool for investigating SR/ER stress mechanisms:

  • Reconstitution Experiments:

    • Purified recombinant REEP5 can be reintroduced into REEP5-depleted cells to determine rescue capabilities

    • Domain-specific mutants can identify critical regions for stress protection

  • SR/ER Stress Pathway Analysis:

    • REEP5 depletion increases ER stress markers (GRp78, GPp94, ATF4)

    • Increased cleaved caspase-12 levels indicate activation of ER-dependent apoptosis

    • Recombinant REEP5 can be used to identify direct interactions with stress response machinery

  • Oxidative Stress Protection Mechanisms:

    • REEP5 depletion results in a twofold increase in reactive oxygen species (ROS)

    • Recombinant REEP5 can be used in cell-free systems to determine direct antioxidant properties

  • Mitochondrial-SR/ER Communication:

    • REEP5 depletion causes significant dissipation of mitochondrial inner membrane electrochemical potential

    • Recombinant REEP5 can help investigate the molecular basis of SR-mitochondria communication

These applications allow researchers to dissect the specific mechanisms by which REEP5 protects against cellular stress and maintains SR/ER integrity under physiological and pathological conditions.

What analytical techniques are most informative for assessing REEP5-mediated effects on SR/ER structure?

Several complementary techniques provide valuable insights into REEP5's effects on SR/ER structure:

  • Advanced Microscopy Approaches:

    • Focused ion beam scanning electron microscopy (FIB-SEM) with 3D reconstruction reveals REEP5's role in maintaining SR integrity

    • Transmission electron microscopy (TEM) detects SR membrane deformation and vacuolization in REEP5-depleted cells

    • Super-resolution microscopy (STORM/PALM) can visualize nanoscale changes in SR/ER tubule diameter and network connectivity

  • Fluorescent Labeling Strategies:

    • ER-Tracker effectively visualizes SR/ER vacuolization after REEP5 knockdown

    • RyR2 immunostaining provides a marker for SR structure in cardiac myocytes

    • Dual-color imaging of SR/ER and other organelles can reveal changes in inter-organelle contact sites

  • Biochemical Membrane Analysis:

    • Subcellular fractionation to isolate SR/ER membranes

    • Lipid composition analysis of isolated membranes

    • Detergent resistance properties as indicators of membrane domain organization

For optimal results, researchers should combine structural analyses with functional assessments, as structural alterations often precede detectable functional changes in calcium handling or contractility.

What are the critical controls and validations required when studying REEP5 function?

When investigating REEP5 function, several critical controls and validations are essential:

  • Expression Validation:

    • qPCR for transcript levels

    • Western blotting with multiple validated antibodies targeting different epitopes

    • Mass spectrometry validation for protein identification

  • Knockdown/Knockout Controls:

    • Multiple shRNA/siRNA sequences to rule out off-target effects

    • Rescue experiments with shRNA-resistant REEP5 constructs

    • Caspase inhibitors (e.g., 100 μM z-vad-fmk) to distinguish between specific phenotypes and cell death

  • Functional Assays:

    • MTT assays to measure cell metabolic state upon REEP5 depletion

    • Mitochondrial membrane potential measurements to assess cellular health

    • Cell stress markers (ROS, ER stress markers) with appropriate positive controls (e.g., tunicamycin treatment)

  • Specificity Controls:

    • Manipulation of other REEP family members to determine specific versus redundant functions

    • Correlation of phenotype severity with level of knockdown/overexpression

    • Time-course analyses to distinguish primary from secondary effects

These controls ensure that observed phenotypes are specifically attributable to REEP5 modulation rather than experimental artifacts or cell death processes.

How can researchers address the challenges of studying membrane proteins like REEP5 in functional assays?

Studying membrane proteins like REEP5 presents several challenges that can be addressed through specialized approaches:

  • Membrane Mimetic Systems:

    • Nanodiscs composed of phospholipid bilayers stabilized by scaffold proteins

    • Liposomes of defined lipid composition for reconstitution studies

    • Bicelles that combine aspects of micelles and bilayers for structural studies

  • Protein Stabilization Strategies:

    • Fusion partners that enhance solubility without compromising function

    • Thermostabilizing mutations identified through directed evolution

    • Antibody fragments or nanobodies that lock proteins in specific conformations

  • Native-Like Expression Systems:

    • Cell-free expression with supplied microsomes or nanodiscs

    • Inducible expression systems with tight regulation to prevent toxicity

    • Co-expression with chaperones or binding partners to enhance folding

  • Specialized Functional Assays:

    • Surface plasmon resonance with captured liposomes for interaction studies

    • Electrophysiological recordings in planar lipid bilayers

    • Microscale thermophoresis for detecting subtle conformational changes

When conducting functional assays with REEP5, researchers should consider the protein's multiple transmembrane domains and ensure that purification methods and assay conditions maintain the native conformation needed for proper function.

What therapeutic potential does REEP5 modulation hold for cardiac disease?

REEP5 modulation presents several promising therapeutic avenues for cardiac disease:

  • Protective Upregulation: Since REEP5 is downregulated in ischemic cardiomyopathy and myocardial infarction models , strategies to restore or increase REEP5 expression might protect against ischemic damage by maintaining SR integrity.

  • Targeted Delivery Approaches: AAV9-based gene therapy vectors have already demonstrated efficacy for cardiac-specific delivery of REEP5 modulators in research settings , providing a translational pathway.

  • Small Molecule Stabilizers: Development of compounds that stabilize REEP5-membrane interactions or enhance REEP5 function could provide pharmacological alternatives to gene therapy.

  • Combination Therapies: REEP5-targeting approaches could potentially complement existing heart failure therapies by addressing the fundamental structural abnormalities in the SR that contribute to calcium handling defects.

  • Diagnostic Applications: REEP5 expression levels could serve as biomarkers for specific types of cardiac pathology, helping to stratify patients for targeted therapies.

The varied expression patterns of REEP5 across different cardiac pathologies suggest that therapeutic approaches would need to be tailored to specific disease contexts, with upregulation beneficial in some conditions but potentially detrimental in others.

How might insights from REEP5 research extend to other membrane-shaping proteins and diseases?

REEP5 research provides valuable paradigms that extend to other membrane-shaping proteins and diseases:

  • Cross-System Applications: The mechanisms by which REEP5 shapes SR/ER membranes likely apply to other specialized ER derivatives in different tissues, such as melanosomes in pigment cells or the nuclear envelope.

  • Neurological Disorders: Other REEP family members (particularly REEP1) are implicated in hereditary spastic paraplegia, suggesting common mechanistic themes in membrane organization across tissues.

  • Metabolic Disorders: SR/ER structure is critical for lipid metabolism and protein secretion, suggesting potential roles for REEP proteins in metabolic diseases.

  • Cancer Biology: ER stress responses influenced by REEP proteins may affect cancer cell survival and adaptation, opening avenues for cancer research.

  • Aging Research: The decline in SR/ER structural integrity with age could involve REEP5 dysfunction, connecting this research to broader questions of cellular aging.

The fundamental principles of how proteins shape biological membranes and how these structures support tissue-specific functions represent a frontier in cell biology with broad implications across multiple disease areas.

What technological advances would accelerate REEP5 research in the coming years?

Several technological advances would significantly accelerate REEP5 research:

  • Structural Biology Breakthroughs:

    • Cryo-electron microscopy of REEP5 in native membrane environments

    • Integrative structural biology approaches combining NMR, X-ray crystallography, and computational modeling

    • Time-resolved structural techniques to capture dynamic conformational changes

  • Advanced Genetic Tools:

    • Tissue-specific, inducible CRISPR systems for precise temporal control of REEP5 editing

    • Base editing and prime editing for introducing specific mutations without double-strand breaks

    • Single-cell lineage tracing combined with REEP5 modulation to track developmental effects

  • Imaging Innovations:

    • Live-cell super-resolution imaging of REEP5 dynamics

    • Correlative light and electron microscopy to link molecular and ultrastructural observations

    • Advanced image analysis algorithms for quantifying subtle changes in SR/ER morphology

  • Computational Approaches:

    • Molecular dynamics simulations of REEP5-membrane interactions

    • Systems biology modeling of SR/ER network formation and maintenance

    • AI-driven predictive models for REEP5 function in different cellular contexts

These technological advances would enable researchers to move beyond descriptive studies to mechanistic understanding and therapeutic modulation of REEP5 function in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.