Recombinant Bovine Receptor expression-enhancing protein 6 (REEP6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
REEP6; Receptor expression-enhancing protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MDGLRQRFERFLEQRNLATEALGALEAKTGVDKRYLATGAATLLSLYLLFGYGAPLLCSL IGFAYPAYASIKAIESPSKEDDTVWLTYWVVYGLFGLAEFFSDLLLSWFPFYYAGKCAFL LFCMAPGPWNGAHMLYHRIIRPLFLKHHEAVDSIVSDISGRALDVAAGMTKDAGKVSVNQ LQKAK
Uniprot No.

Target Background

Function

REEP6 is essential for the proper function and survival of retinal photoreceptors and plays a critical role in retinal development. In rod photoreceptors, it contributes to the stability and/or trafficking of guanylate cyclases and is necessary for maintaining endoplasmic reticulum and mitochondrial homeostasis. It may also be involved in clathrin-mediated intracellular vesicle trafficking of proteins from the endoplasmic reticulum to the retinal rod plasma membrane.

Database Links
Protein Families
DP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasmic vesicle, clathrin-coated vesicle membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the retina (at protein level).

Q&A

What is REEP6 and what is its primary function in photoreceptors?

REEP6 is a member of the Receptor Expression Enhancing Protein family involved in intracellular transport of receptors to the plasma membrane. In rod photoreceptors, REEP6 plays a critical role in trafficking of cargo via a subset of Clathrin-coated vesicles to selected membrane sites . This function is essential for the maintenance of photoreceptor health and visual signal transduction. Unlike other REEP family members that primarily function in endoplasmic reticulum shaping, REEP6 appears to have specialized in vesicular transport in highly polarized rod photoreceptor cells . The rod-specific isoform of REEP6 contains an additional 27 amino acid residues compared to other isoforms and is regulated by the Maf-family leucine zipper transcription factor NRL, which determines rod cell fate and differentiation .

How is REEP6 expression regulated in rod photoreceptors?

REEP6 expression in rod photoreceptors is regulated by the transcription factor NRL (Neural Retina Leucine zipper), which is essential for rod photoreceptor development and function . The rod-specific isoform of REEP6 differs from other isoforms by including an additional 27 amino acid residues . Transcriptome analysis of Reep6-/- mouse retina at early stages before the onset of degeneration revealed dysregulation of several genes, including a seven-fold higher expression of glial fibrillary acidic protein (Gfap), which is a hallmark of retinal stress . By postnatal day 21, approximately 94 genes showed differential expression (>2-fold change) in Reep6-/- mice compared to wild-type controls, indicating that REEP6 absence affects multiple cellular pathways .

What mechanisms underlie REEP6-mediated trafficking in rod photoreceptors?

REEP6 appears to function as a specialized mediator of vesicular trafficking in rod photoreceptors through several mechanisms:

  • Association with Clathrin-coated vesicles: REEP6 is detected in a subset of Clathrin-coated vesicles, suggesting selectivity in cargo transport . Mass spectrometry analysis identified Clathrin Heavy Chain (CHC) in anti-REEP6 immunoprecipitated proteins from mouse retina, confirming this association .

  • Interaction with t-SNARE proteins: REEP6 interacts with Syntaxin3 (STX3), a t-SNARE protein involved in vesicle targeting and fusion . This interaction suggests that REEP6 may function as a v-SNARE-like molecule, facilitating the docking of specific Clathrin-coated vesicles at STX3-resident plasma membrane sites .

  • Selective cargo trafficking: Loss of REEP6 in mice leads to reduced levels of specific phototransduction proteins including CNGB1, GARP, GNAT1, and AIPL1, while others like rhodopsin and PDE6D remain unaffected . This selective effect suggests that REEP6 mediates the trafficking of specific cargo molecules rather than general vesicular transport.

The vectorial transport mediated by REEP6 appears critical for delivering specific proteins to their proper destinations within the highly compartmentalized rod photoreceptors, supporting their extraordinary rates of membrane synthesis and turnover .

What phenotypes are observed in REEP6 knockout models?

Deletion of Reep6 in mice results in progressive retinal degeneration with the following phenotypic characteristics:

  • Electrophysiological changes: At one month of age, Reep6-/- mice show reduced rod electroretinogram (ERG) responses with decreased amplitudes of both the scotopic a-wave (generated by rod photoreceptors) and b-wave (generated mostly by bipolar cells) . The scotopic response continues to decline and is almost undetectable by 12 months .

  • Selective protein deficiencies: While rhodopsin levels remain similar to wild-type, REEP6-deficient retinas show decreased levels of rod cyclic nucleotide gated channel β1 (CNGB1), GARP, transducin-α (GNAT1), and AIPL1 (a chaperone of phosphodiesterase 6) .

  • Cellular abnormalities: REEP6-deficient retinas develop vacuole-like structures at the apical inner segment, similar to those reported in mice with defective vesicle trafficking .

  • Molecular stress responses: Transcriptome analysis of Reep6-/- retinas shows upregulation of stress response genes, including a seven-fold increase in glial fibrillary acidic protein (Gfap), a marker of retinal stress .

  • Cone preservation: While rod function is severely compromised early on, cone photoreceptor function (measured by photopic ERG response) shows a decrease only by 12 months of age, indicating a primarily rod-specific effect of REEP6 deficiency .

These phenotypic features collectively support the critical role of REEP6 in rod photoreceptor function and survival through its involvement in protein trafficking.

How do REEP6 mutations contribute to retinitis pigmentosa?

Whole exome sequencing identified a homozygous missense variant (c.223G > A: p.E75K) in REEP6 in two retinitis pigmentosa families of different ethnicities (one American and one Chinese) . This variant alters a highly conserved glutamic acid residue (Glu75) within the TB2_DP1_HVA22 domain of REEP6 .

The E75K mutation is extremely rare in different populations (MAF = 0.00006654 in ExAC database) and is predicted to be pathogenic by multiple computational tools . The mutation site falls within several important linear motifs, including:

  • A Class IV WW domain interaction motif (residues 73-78)

  • A substrate motif for phosphorylation by cyclin-dependent protein kinase (residues 73-79)

  • A proline-directed kinase phosphorylation site (residues 73-79)

The functional importance of the TB2_DP1_HVA22 domain may be associated with phosphorylation of the ESPSK site, which contains the E75 residue . The E75K mutation likely disrupts this phosphorylation site, potentially affecting REEP6's ability to mediate vesicular trafficking and thus leading to rod dysfunction and ultimately retinitis pigmentosa.

This genetic evidence, together with the phenotypic consequences of REEP6 deletion in mice, strongly supports the causal relationship between REEP6 dysfunction and rod photoreceptor degeneration in retinitis pigmentosa.

What are the optimal conditions for expressing and purifying recombinant REEP6?

For successful expression and purification of recombinant REEP6:

  • Expression system: E. coli has been successfully used for expressing full-length bovine REEP6 with an N-terminal His tag . This system provides good yield and allows for straightforward purification.

  • Protein specifications: The full-length bovine REEP6 protein (Q32LG5) spans amino acids 1-185 and can be expressed with an N-terminal His tag to facilitate purification .

  • Purification method: Affinity chromatography using the His tag allows for purification to greater than 90% purity as determined by SDS-PAGE .

  • Storage conditions: The purified protein should be stored as a lyophilized powder. Upon receipt, it should be stored at -20°C/-80°C, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

    • Working aliquots can be stored at 4°C for up to one week

  • Storage buffer: A Tris/PBS-based buffer with 6% Trehalose, pH 8.0 is recommended for storage .

These conditions ensure stability and activity of the recombinant REEP6 protein for subsequent experimental applications.

What techniques are most effective for studying REEP6-mediated vesicle trafficking?

Based on the research methodologies described in the literature, several techniques have proven effective for investigating REEP6's role in vesicular trafficking:

  • Vesicle fractionation: Purification of vesicle fractions from retinal extracts can be used to examine the association of REEP6 with specific vesicle populations. This technique successfully demonstrated REEP6 enrichment in fractions containing Clathrin-coated vesicles .

  • Co-immunoprecipitation: This approach effectively revealed REEP6's interactions with Clathrin Heavy Chain and Syntaxin3, providing insights into its role in vesicle trafficking and targeting .

  • Immuno-electron microscopy: This technique allowed visualization of REEP6 on vesicles with characteristic triskelion structure of Clathrin-coated vesicles, confirming its specific localization .

  • High-resolution immunofluorescence microscopy: This method demonstrated co-localization of REEP6 and Clathrin in rod spherules and in the rod cytoplasm, providing spatial information about REEP6's distribution .

  • Knockout mouse models: Gene deletion studies in mice provided functional evidence of REEP6's role in trafficking by revealing phenotypic consequences such as rod dysfunction and specific protein deficiencies .

  • Transcriptome analysis: RNA-seq of wild-type and Reep6-/- retinas at different developmental stages revealed downstream effects of REEP6 deficiency and helped identify stress response pathways activated in its absence .

  • Protein level analysis: Immunofluorescent staining and immunoblot analysis of retinal proteins in wild-type and knockout mice revealed specific changes in phototransduction proteins, highlighting REEP6's selective role in protein trafficking .

Combined application of these techniques provides complementary insights into REEP6's function in vesicular trafficking and its importance for photoreceptor health.

What experimental approaches can be used to characterize REEP6 interactions with membrane proteins?

To investigate REEP6's interactions with membrane proteins and its role in vesicular trafficking, researchers can employ several complementary approaches:

  • Proximity labeling techniques: Methods such as BioID or APEX2 can identify proteins in close proximity to REEP6 in live cells, potentially revealing novel interaction partners and cargo proteins.

  • Fluorescence resonance energy transfer (FRET): This technique can detect direct protein-protein interactions between REEP6 and potential binding partners in intact cells, providing spatial and temporal information about these interactions.

  • Surface plasmon resonance (SPR): SPR allows for quantitative measurement of binding kinetics between purified REEP6 and its interaction partners, helping determine binding affinities and interaction dynamics.

  • Crosslinking mass spectrometry: This approach can identify specific residues involved in protein-protein interactions, providing structural insights into how REEP6 interacts with Clathrin, Syntaxin3, and other partners.

  • Cryo-electron microscopy: This technique could potentially visualize REEP6-containing vesicles at high resolution, revealing the structural organization of REEP6 within Clathrin-coated vesicles.

  • Live-cell imaging with fluorescently tagged proteins: Tracking the movement of fluorescently labeled REEP6 and candidate cargo proteins can provide insights into trafficking dynamics and colocalization patterns.

The research with REEP6 has already utilized mass spectrometry to identify interaction partners (Clathrin Heavy Chain and Syntaxin3) and immunoelectron microscopy to localize REEP6 to Clathrin-coated vesicles . These established methods provide a foundation for more detailed characterization of REEP6's molecular interactions.

How might understanding REEP6 function inform therapeutic strategies for retinitis pigmentosa?

Understanding REEP6's role in vesicular trafficking and retinal health offers several potential avenues for therapeutic development:

  • Gene therapy approaches: Identification of REEP6 mutations in retinitis pigmentosa patients provides a clear target for gene replacement therapy. AAV-mediated delivery of functional REEP6 to rod photoreceptors could potentially rescue the degenerative phenotype in patients with REEP6 mutations .

  • Small molecule modulators: Compounds that enhance vesicular trafficking or stabilize specific protein interactions could potentially compensate for REEP6 dysfunction. Understanding the molecular mechanism of how the E75K mutation affects REEP6 function could guide the development of targeted therapeutics .

  • Protein stabilization strategies: Since REEP6 deficiency leads to decreased levels of specific phototransduction proteins like CNGB1, GNAT1, and AIPL1, approaches that stabilize these proteins or enhance their trafficking through alternative pathways could provide therapeutic benefit .

  • Biomarker development: The selective deficiencies in specific proteins observed in REEP6-deficient retinas could serve as biomarkers for monitoring disease progression and treatment response in retinitis pigmentosa patients .

The connection between REEP6 mutation and retinitis pigmentosa highlights the importance of protein trafficking in photoreceptor health and suggests that similar mechanisms may underlie other forms of retinal degeneration. This broader understanding could inform therapeutic strategies not only for REEP6-associated retinitis pigmentosa but potentially for other retinal degenerative diseases as well.

What are the key unresolved questions about REEP6 biology and function?

Despite significant advances in understanding REEP6's role in vesicular trafficking and retinal health, several important questions remain unanswered:

  • Cargo specificity mechanism: How does REEP6 selectively recognize and transport specific cargo proteins while excluding others? The molecular basis for this selectivity remains unclear .

  • Regulatory mechanisms: What factors regulate REEP6 activity and how is its function coordinated with other components of the vesicular trafficking machinery? The potential role of phosphorylation at the ESPSK site warrants further investigation .

  • REEP family functional diversity: How do the functions of different REEP family members overlap or differ, particularly in specialized neurons like photoreceptors? While REEP1 is involved in ER shaping and hereditary spastic paraplegia, REEP6 appears to have evolved specialized roles in vesicular trafficking .

  • Pathogenic mechanisms: How exactly does the E75K mutation disrupt REEP6 function at the molecular level, and are there other REEP6 mutations that may contribute to retinal degeneration through different mechanisms?

  • Therapeutic potential: Can restoration or enhancement of REEP6 function prevent or slow photoreceptor degeneration, and what therapeutic approaches might be most effective for different types of REEP6 dysfunction?

Addressing these questions will require integration of structural biology, cell biology, and in vivo studies to fully elucidate REEP6's role in maintaining photoreceptor health and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.