Recombinant Bovine Retinol dehydrogenase 8 (RDH8)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bovine Retinol Dehydrogenase 8 (RDH8) is an enzyme that plays a crucial role in the visual cycle, specifically in the reduction of all-trans-retinal to all-trans-retinol in vertebrate photoreceptors . RDH8 belongs to the retinol dehydrogenase (RDH) family, which are essential for vitamin A metabolism and visual function .

Visual Cycle and RDH8's Function

The visual cycle is a biochemical pathway vital for vision. After light exposure, the visual pigment rhodopsin in photoreceptor cells is bleached, leading to the release of all-trans-retinal . To regenerate the visual pigment, all-trans-retinal must be converted back to its cis form. RDH8 facilitates the initial step in this process by reducing all-trans-retinal to all-trans-retinol .

In the retina, all-trans-retinal clearance is primarily managed by RDH8 in conjunction with the ATP-binding cassette transporter 4 (ABCA4) . ABCA4 transports all-trans-retinal from the inner leaflets of photoreceptor discs to the cytosol, where RDH8 is located .

Expression and Localization

RDH8 is expressed in both rods and cones, with higher abundance in cones . Within photoreceptor cells, RDH8 is mainly localized in the outer segment (OS) . Studies on carp retina have shown that RDH8 is one of the major RDH subtypes expressed, along with RDH8L2 and RDH13 .

RDH SubtypeLocalizationRelative Abundance in Carp Retina
RDH8Outer Segment (OS)High
RDH8L2Inner Segment (IS)Highest
RDH13Inner Segment (IS)High

Enzymatic Activity

RDH8 exhibits high efficiency in reducing all-trans-retinal. Specific activity measurements using recombinant RDH proteins have shown that RDH8 has a significantly higher activity compared to other RDHs like RDH8L2 and RDH13 . In vitro studies have reported that the enzymatic properties of recombinant bovine RDH8 closely resemble those of native RDH activity found in bovine rod outer segment preparations .

The specific activities of RDH8, RDH8L2, and RDH13 were found to be 27.8 ± 10.1, 1.9 ± 0.9, and 1.5 ± 0.3 molecules of all-trans-retinol/RDH molecule-sec, respectively .

Role in Retinal Health and Disease

RDH8 plays a protective role in the retina by facilitating the clearance of all-trans-retinal, which is toxic when accumulated . Issues in all-trans-retinal clearance can result in the buildup of condensation products like A2E and all-trans-retinal dimer (RALdi), both linked to macular degeneration .

Studies using knockout mice have highlighted the importance of RDH8 in maintaining retinal health. For example, Rdh8−/−Abca4−/− mice exhibit progressive retinal degeneration,displaying the importance of RDH8 and ABCA4 in preventing retinal damage . These mice serve as a model for studying Stargardt disease and age-related macular degeneration (AMD) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RDH8; PRRDH; Retinol dehydrogenase 8; Photoreceptor outer segment all-trans retinol dehydrogenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
RDH8
Target Protein Sequence
MADAPRTVLISGCSSGIGLELAVQLAHDPRQRYQVVATMRDLGKKGTLETAAGEALGQTL TVAQLDVCSDESVAQCLNCIQGGEVDVLVNNAGVGLVGPLEGLSLAAMQNVFDTNFFGAV RLVKAVLPSMKRRRQGHIVVVSSVMGLQGVVFNEVYAASKFAMEGFFESLAVQLLQFNIF ISLVEPGPVVTEFEGKLLEQVSTAEFPGTDPDTLSYFRDLYLPASRELFHNVGQSPQDVA KVIVKVIGSARPPLRRRTNTRYTPLIALKAMDPSGSLYVRTSHCLLFRWPRLLNLGLRCL ACSCFRTPVWPR
Uniprot No.

Target Background

Function
Recombinant Bovine Retinol Dehydrogenase 8 (RDH8) is a retinol dehydrogenase exhibiting a strong preference for NADP+. It catalyzes the conversion of all-trans-retinal to all-trans-retinol and may play a crucial role in visual pigment regeneration under high light intensity.
Database Links

KEGG: bta:281449

STRING: 9913.ENSBTAP00000013443

UniGene: Bt.266

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in photoreceptor outer segments in the retina (at protein level).

Q&A

What is the primary function of RDH8 in the visual cycle?

RDH8 is a retinol dehydrogenase that catalyzes the reduction of all-trans retinal to all-trans retinol following visual pigment bleaching in vertebrate photoreceptors. This critical step represents one of the initial phases in the retinoid cycle that ultimately leads to the regeneration of visual pigments. The enzymatic activity of RDH8 helps prevent the toxic accumulation of all-trans retinal in photoreceptor cells while simultaneously providing substrate for subsequent visual cycle reactions .

How does RDH8 expression differ between rod and cone photoreceptors?

Cone photoreceptors exhibit significantly higher RDH8 expression levels compared to rods. Quantitative studies have demonstrated that the reducing activity toward all-trans retinal in cone outer segments is more than 30 times higher than that found in rods. This marked difference in enzymatic capacity has been directly attributed to the substantially higher content of RDH8 in cones .

What cellular compartment contains the highest concentration of RDH8?

RDH8 is predominantly localized in the outer segment (OS) of photoreceptors, with particularly high concentrations found in cone photoreceptor OSs. This strategic localization places the enzyme in the precise cellular location where all-trans retinal is generated following photopigment bleaching, allowing for efficient processing of this potentially toxic intermediate .

What techniques are most effective for measuring RDH8 enzymatic activity?

The most reliable approach for quantifying RDH8 activity involves measuring the rate of all-trans retinol formation. Standard protocols include incubating purified photoreceptor outer segments with NADPH (the required cofactor) and all-trans retinal substrate, then monitoring the conversion rate. The specific activity is typically expressed as attomoles of all-trans retinol formed per cell per second (amol atROL/cell-sec). In comparative studies, cone preparations show approximately 12.4 ± 1.4 amol atROL/cone-sec, while rods exhibit around 1.6 ± 0.2 amol atROL/rod-sec .

How can researchers account for cross-contamination in photoreceptor preparations when studying RDH8?

When working with rod preparations, which may contain small amounts of contaminating cones, researchers must implement correction factors to account for the significantly higher RDH8 activity in cones. Given that cone-derived activity can substantially skew measurements, quantitative adjustments based on the percentage of cone contamination are essential. This typically involves determining the cone/rod ratio in the preparation and mathematically subtracting the estimated cone contribution from total measured activity .

What expression systems yield functional recombinant bovine RDH8?

For successful expression of functional recombinant bovine RDH8, mammalian expression systems such as HEK293T cells have proven effective. These systems provide the appropriate cellular machinery for proper protein folding and post-translational modifications required for RDH8 activity. When designing expression constructs, inclusion of appropriate targeting sequences ensures correct subcellular localization, while affinity tags facilitate subsequent purification while maintaining enzymatic function .

How does RDH8 compare functionally to other retinol dehydrogenases in the visual cycle?

While RDH8 primarily operates in photoreceptor outer segments to reduce all-trans retinal to all-trans retinol, other RDHs serve complementary functions in different cellular compartments. For instance, RDH5 functions predominantly in the RPE to oxidize 11-cis-retinol to 11-cis-retinal. Notably, RDH8 demonstrates approximately 8 times higher per-cell activity in cones versus rods, whereas RDH5 has been shown to potentially interact with other visual cycle proteins including RGR, suggesting these enzymes may operate within different protein complexes to optimize visual cycle efficiency .

What is the significance of the coupled oxidation-reduction reaction involving RDH8 in cone photoreceptors?

In cone photoreceptors, researchers have identified a highly efficient coupled reaction where the reduction of all-trans retinal to all-trans retinol (catalyzed by RDH8) is directly coupled with the oxidation of 11-cis retinol to 11-cis retinal. This reaction does not require NADP+ as would be expected for typical oxidation reactions and is more than 50 times more efficient than standard NADP+-dependent RDH oxidizing activity. This coupled mechanism likely represents a specialized adaptation in cones that ensures rapid visual pigment regeneration under bright light conditions where cones predominantly function .

How do the kinetic properties of RDH8 contribute to photoreceptor dark adaptation?

The high enzymatic capacity of RDH8, particularly in cones, facilitates rapid reduction of all-trans retinal following bleaching events. The measured activity of 12.4 ± 1.4 amol atROL/cone-sec enables efficient clearance of potentially toxic all-trans retinal while simultaneously initiating the visual cycle. This rapid processing is critical for dark adaptation, especially in cones that must function across widely varying light intensities. The heightened activity in cones versus rods (approximately 8-fold difference on a per-cell basis) likely contributes to the faster dark adaptation kinetics observed in cone-mediated vision .

Does RDH8 function independently or as part of protein complexes?

Current evidence suggests RDH8 may function as part of larger protein complexes in the visual cycle machinery. While direct evidence for RDH8-specific complexes is limited, research on related visual cycle proteins demonstrates that enzymes such as RDH5, RPE65, CRALBP, and RGR can co-immunoprecipitate as a complex. By analogy, RDH8 likely participates in similar protein-protein interactions that optimize the spatial organization and functional efficiency of the visual cycle apparatus .

How might RDH8 interact with substrate transport proteins in photoreceptors?

Though specific RDH8 interactions with transport proteins are not fully characterized, the efficacy of RDH8 activity likely depends on coordinated interactions with proteins that facilitate substrate delivery. Cellular retinaldehyde-binding protein (CRALBP) serves as a known acceptor for retinoids in the visual cycle, suggesting potential functional coupling between RDH8 and CRALBP to efficiently channel retinoids through sequential enzymatic steps .

What methodology best detects protein-protein interactions involving RDH8?

Co-immunoprecipitation studies have successfully identified protein complexes within the visual cycle apparatus. For examining RDH8-specific interactions, researchers should consider employing antibodies targeting RDH8 for pull-down experiments, followed by mass spectrometry analysis of co-precipitated proteins. Additionally, proximity labeling approaches such as BioID or APEX can identify transient or weak interactions that might be disrupted during traditional co-immunoprecipitation procedures .

How does bovine RDH8 activity compare to RDH8 from other vertebrate species?

Comparative studies between species provide insights into evolutionary adaptations of the visual cycle. Research on carp photoreceptors has shown similar patterns to bovine studies, with significantly higher RDH8 activity in cones versus rods. The conservation of this differential expression pattern across distantly related vertebrates suggests fundamental evolutionary pressure to maintain higher RDH8 activity in cone photoreceptors across diverse visual environments and ecological niches .

What can different animal models contribute to our understanding of RDH8 function?

Different animal models offer unique advantages for studying RDH8 function. Carp models have proven valuable for isolating and purifying cone photoreceptors in sufficient quantities for biochemical analysis, enabling direct measurement of RDH8 activity. Bovine retinas provide abundant material for protein purification and biochemical characterization. These comparative approaches have revealed consistent patterns of enhanced RDH8 activity in cone versus rod photoreceptors across species, suggesting evolutionary conservation of this fundamental aspect of visual cycle biochemistry .

What are the critical controls needed when measuring RDH8 activity in photoreceptor preparations?

When designing experiments to measure RDH8 activity, several critical controls must be implemented. First, researchers must account for cone contamination in rod preparations by quantifying the percentage of cones and mathematically correcting the activity measurements. Second, parallel assays without NADPH addition confirm the specificity of the measured activity for RDH8. Third, spectral analysis of the reaction products via HPLC confirms the identity of the all-trans retinol product. Finally, temperature and pH must be carefully controlled as these factors significantly influence enzymatic activity rates .

How should researchers isolate pure photoreceptor populations for RDH8 analysis?

For accurate analysis of RDH8 in specific photoreceptor subtypes, density gradient centrifugation methods have proven effective for separating rods from cones. Following isolation, photoreceptor identity and purity should be verified through immunostaining with rod- and cone-specific markers. When studying mixed populations, mathematical corrections based on the determined rod/cone ratio should be applied to activity measurements. Additionally, single-cell isolation techniques may provide the highest purity for subsequent analysis of RDH8 expression and activity .

How does RDH8 activity coordinate with RPE65 function in the visual cycle?

While RDH8 functions primarily in photoreceptors to reduce all-trans retinal to all-trans retinol, RPE65 operates in the retinal pigment epithelium (RPE) to simultaneously hydrolyze and isomerize all-trans-retinyl esters to 11-cis-retinol. These enzymes function in different cellular compartments but are functionally coupled in the visual cycle. Evidence suggests that visual cycle proteins including RPE65, RDH5, CRALBP, and RGR may physically associate in protein complexes, though direct evidence for RDH8 participation in such complexes with RPE65 remains limited .

What is the relationship between RDH8 and the RGR-mediated pathway of chromophore regeneration?

RDH8 and the RGR-mediated pathway represent complementary mechanisms supporting visual chromophore regeneration. While RDH8 reduces all-trans retinal to all-trans retinol in photoreceptors, RGR functions as a photoisomerase in the RPE and Müller glia, converting all-trans-retinal to 11-cis-retinal upon light exposure. These pathways likely work in concert to ensure sufficient 11-cis-retinal is available for visual pigment regeneration, particularly under bright light conditions where cone photoreceptors with high RDH8 content predominantly function .

What structural studies would advance our understanding of RDH8 function?

Future structural studies should focus on determining the three-dimensional crystal structure of RDH8, which would provide critical insights into its substrate binding pocket, cofactor interactions, and potential protein-protein interaction domains. Additionally, site-directed mutagenesis studies targeting conserved residues would help identify amino acids essential for catalytic activity, substrate specificity, and protein stability. These structural insights could inform the development of specific modulators of RDH8 activity for research and potentially therapeutic applications .

How might gene editing approaches contribute to RDH8 research?

CRISPR-Cas9 gene editing approaches offer powerful tools for investigating RDH8 function. Creating precise RDH8 knockout models would allow researchers to directly assess the consequences of RDH8 deficiency on visual cycle kinetics and photoreceptor health. Additionally, knock-in models expressing tagged versions of RDH8 would facilitate tracking of protein localization, dynamics, and interactions in living cells. These approaches would complement biochemical studies and provide systems-level insights into RDH8 function within the complex visual cycle machinery .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.