Recombinant Bovine Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Description

Production Methods for Recombinant Bovine Rhodopsin

The production of functional recombinant bovine rhodopsin has been achieved through various expression systems, with bacterial and insect cell systems being the most commonly employed. These methods have evolved to address the challenges inherent in membrane protein expression, including proper folding, post-translational modifications, and functional reconstitution.

Escherichia coli Expression System

Recombinant bovine rhodopsin can be expressed in E. coli systems, typically resulting in a protein with a predicted molecular weight of 19.5 kDa . This approach often involves the use of fusion partners or solubility tags to improve expression and folding. Commercial preparations of E. coli-expressed rhodopsin are typically supplied in a lyophilized form from filtered concentrated solutions containing appropriate buffers and salt concentrations .

While E. coli systems offer advantages in terms of scalability and cost-effectiveness, they may present challenges regarding post-translational modifications and proper membrane protein folding. Nevertheless, they remain valuable for certain applications, particularly when structural studies do not require native glycosylation patterns.

Baculovirus Expression System

The baculovirus/Sf9 insect cell-based expression system has emerged as a particularly effective method for producing functional recombinant bovine rhodopsin in larger quantities. This approach utilizes serum-free and protein-free growth medium in large-scale bioreactor cultures . After optimization procedures, expression levels as high as 4 mg/l have been achieved .

The baculovirus system offers several advantages for rhodopsin production:

  • Higher expression levels compared to mammalian systems

  • Proper protein folding and post-translational modifications

  • Ability to scale up to bioreactor volumes

  • Production of functionally active protein

This method has proven particularly valuable for producing the quantities necessary for detailed biochemical and structural biophysical studies that are essential for understanding the molecular mechanisms of rhodopsin function .

Purification Techniques

The purification of recombinant bovine rhodopsin presents particular challenges due to its hydrophobic nature as a membrane protein. Several strategies have been developed to isolate the protein while maintaining its functional integrity.

  1. Cell lysis and membrane fraction isolation

  2. Solubilization using appropriate detergents

  3. IMAC purification using the affinity tag

  4. Reconstitution into a native lipid environment

After reconstitution into a native lipid environment, properly purified recombinant rhodopsin has been shown to be functionally indistinguishable from native rhodopsin with regard to several key parameters, including spectral absorbance, structural changes following photoactivation, and G-protein activation capacity .

Functional Properties

Recombinant bovine rhodopsin, when properly expressed and reconstituted, exhibits functional properties that closely mirror those of the native protein isolated from bovine retina. These properties include characteristic spectral absorbance, photoactivation mechanisms, and G-protein coupling abilities.

Spectral Characteristics

Bovine rhodopsin exhibits a distinctive spectral absorbance profile with a maximum absorption at approximately 500 nm, corresponding to the presence of the 11-cis-retinal chromophore. Upon light absorption, this profile changes as the chromophore isomerizes to the all-trans form, resulting in the formation of metarhodopsin intermediates with altered spectral properties.

The spectral characteristics of properly reconstituted recombinant rhodopsin are essentially identical to those of native rhodopsin, confirming the structural integrity of the recombinant protein . This spectral similarity serves as an important quality control parameter during the production and purification process.

Photoactivation Mechanism

The photoactivation of rhodopsin begins with the absorption of a photon by the 11-cis-retinal chromophore, which isomerizes to the all-trans configuration within approximately 200 femtoseconds . This ultrafast isomerization event triggers a series of conformational changes in the protein structure, ultimately leading to the activation of the associated G protein, transducin.

Recent studies using ultrafast time-resolved crystallography at room temperature have provided insights into how the isomerized twisted all-trans retinal stores the photon energy required to initiate protein conformational changes . The distorted retinal at a 1-picosecond time delay after photoactivation has been shown to pull away from approximately half of its numerous interactions with its binding pocket, with the excess photon energy being released through an anisotropic protein breathing motion directed toward the extracellular space .

G-protein Activation

Following photoactivation, rhodopsin undergoes conformational changes that enable it to interact with and activate the heterotrimeric G protein transducin. This interaction involves specific molecular contacts between the activated receptor and the G protein subunits.

Cryo-electron microscopy studies of the rhodopsin-Gαi-βγ complex have revealed that the receptor's C-terminal tail binds to the Gβ subunit of the G protein . This structural insight provides a foundation for understanding the role of the C-terminal tail in GPCR signaling and of Gβ as a scaffold for recruiting Gα subunits and G protein-receptor kinases.

Importantly, recombinant bovine rhodopsin, when properly reconstituted, demonstrates G-protein activation capabilities that are functionally indistinguishable from native rhodopsin . This functional equivalence further validates the use of recombinant systems for studying the molecular mechanisms of rhodopsin-mediated signaling.

Water Molecules and Functional Regulation

X-ray diffraction studies to 2.6 Å resolution have revealed the presence of water molecules in the transmembrane region of bovine rhodopsin that play crucial functional roles . These water molecules are observed in the vicinity of highly conserved residues and in the retinal pocket, suggesting their involvement in regulating the activity of rhodopsin-like GPCRs and in spectral tuning in visual pigments .

The initial structural model of bovine rhodopsin contained only one water molecule in the transmembrane region, which was hydrogen bonded to specific amino acid residues . Subsequent higher-resolution studies have identified additional water molecules that form part of an extended hydrogen-bonding network, contributing to the stability of the receptor's inactive state and participating in the activation mechanism.

Single-crystal microspectrophotometry performed on rhodopsin crystals has confirmed that these structural findings are physiologically relevant, as the spectroscopic properties of the crystallized protein are similar to those previously observed using bovine rhodopsin in suspension or membrane environments .

Comparative Insights: Bistable vs. Monostable Rhodopsins

Research comparing bovine rhodopsin (a monostable rhodopsin) with bistable rhodopsins from other species has provided valuable insights into the structural basis for their functional differences. Monostable rhodopsins like bovine rhodopsin release retinal upon isomerization, while bistable rhodopsins can "reisomerize" the retinal upon absorption of a second photon .

Crystal structures of bistable rhodopsins, such as jumping spider rhodopsin-1, have revealed a water-mediated network around the retinal ligand that may be the basis for their bistable nature . In contrast to bovine rhodopsin, the transmembrane bundle of bistable rhodopsins adopts a more "activation-ready" conformation, similar to what is observed in other non-photosensitive class A GPCRs .

These comparative studies highlight the versatility of rhodopsin-like proteins across different species and provide insights into the molecular mechanisms underlying their diverse functional properties. The insights gained from such comparisons contribute to our understanding of GPCR activation mechanisms more broadly.

Table 3: Comparison of Monostable (Bovine) and Bistable Rhodopsins

PropertyMonostable (Bovine) RhodopsinBistable Rhodopsins
Retinal Fate After IsomerizationReleasedRetained
ReisomerizationNoYes, upon second photon absorption
Transmembrane Bundle ConformationLess "activation-ready"More "activation-ready"
Water-Mediated NetworkLess extensiveMore extensive around retinal
Conformational SimilarityDistinct from non-photosensitive GPCRsSimilar to non-photosensitive class A GPCRs

Applications in Research

Recombinant bovine rhodopsin has become an invaluable tool in various research contexts, offering advantages over native protein sources in terms of availability, consistency, and potential for modification. Key applications include:

  1. Structural Biology: The ability to produce large quantities of recombinant rhodopsin has facilitated its crystallization and structural determination by X-ray crystallography and cryo-electron microscopy, providing fundamental insights into GPCR architecture and function .

  2. Drug Discovery: As a prototypical GPCR, recombinant rhodopsin serves as a model system for studying ligand binding and receptor activation, informing the design of drugs targeting other members of the GPCR family.

  3. Biophysical Studies: Recombinant rhodopsin enables detailed investigations of protein dynamics, conformational changes, and energy transfer mechanisms using techniques such as spectroscopy, fluorescence, and computational modeling.

  4. Optogenetics: The understanding gained from studies of recombinant rhodopsin has contributed to the development of optogenetic tools, which allow for light-controlled manipulation of cellular activity in neuroscience research.

The ability to produce and purify tens of milligrams of functional recombinant rhodopsin meets the ever-increasing demand for material necessary to perform detailed biochemical and structural biophysical studies that are essential for unraveling its working mechanism at a molecular level .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based solution containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used prior to lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the delivery form, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
3-7 business days
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
1-348aa
Mol. Weight
45.0 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Source
in vitro E.coli expression system
Species
Bos taurus (Bovine)
Target Names
RHO
Target Protein Sequence
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision in low light conditions. It plays a critical role in photoreceptor cell survival after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by the arrestin SAG, terminating signaling.
Gene References Into Functions
  1. Data indicate that loops within the C-edge of arrestin function as a membrane anchor, as shown through molecular dynamics simulations and site-directed fluorescence experiments on arrestin-1 interactions with rhodopsin. PMID: 28220785
  2. The photoreceptor pathology associated with expression of Retinitis pigmentosa-associated rhodopsin pigments arises from their unexpected inability to dimerize via transmembrane helices 1 and 5. PMID: 27694816
  3. The rhodopsin mutant E113Q has potential as a template for anion biosensors at visible wavelengths. PMID: 27865136
  4. The study demonstrates that, compared to the inactive 11-cis-retinal case, trans-retinal rhodopsin can undergo protonated Schiff base (PSB) deprotonation due to a change in retinal conformation and a consequent alteration in the hydrogen-bond (HB) network embedding PSB and the counterion Glu113. PMID: 28731695
  5. Data suggest that the retinitis pigmentosa-associated mutation G51A exhibits different behavior in human rhodopsin compared to bovine rhodopsin; human rhodopsin demonstrates greater thermal stability than ancestrally reconstructed mammalian rhodopsin. PMID: 28369862
  6. These findings revealed a total water flux between the bulk and the protein interior in the Meta II state, suggesting that these pathways provide water molecules to crucial sites within the activated rhodopsin. PMID: 28493967
  7. Data indicate the formation of a hetero-multimer complex between light-activated rhodopsin and light-activated heterotrimeric transducin (T-alpha-1, Gnb1, Gngt1) with a 1:1 rhodopsin:transducin stoichiometry. This complex appears to form on native rod outer segment membranes upon light activation. PMID: 28655769
  8. A comprehensive analysis of the kinetics and thermodynamics of the recombination reaction between opsin and 11-cis-retinal (11CR) to form the mature visual pigment, Rho, reveals that the lipid bilayer environment is crucial for ligand binding in Rho. PMID: 28700926
  9. In response to light-induced isomerization of the retinal chromophore rhodopsin, hydrogen-bonding interactions involving these C=O groups are released, facilitating repacking of H5 and H7 onto the transmembrane core of the receptor. PMID: 27376589
  10. Rhodopsin can accommodate a second Lys in the retinal binding pocket, suggesting that an evolutionary intermediate with two Lys could allow migration of the Schiff base Lys to a position different from the highly conserved location observed in the seventh TM helix. PMID: 27486845
  11. Multiconfigurational quantum chemistry is employed to compare the isomerization mechanisms of sensory rhodopsin from the cyanobacterium Anabaena PCC 7120 (ASR) and bovine rhodopsin (Rh). PMID: 26607446
  12. While the basic activation pathways of human and bovine rhodopsin are similar, structural deviations exist in the inactive conformation and during receptor activation, even between closely related rhodopsins. PMID: 26105054
  13. Data suggest that, upon activation/deactivation of RHO, the main conformational changes observed in molecular dynamic simulations are distributed throughout the transmembrane bundle rather than localized to specific sites (e.g., conserved sequences). PMID: 24889093
  14. DMPC/DHPC bicelles significantly increase the thermal stability of rhodopsin mutants G90V and N55K. PMID: 26181234
  15. The molecular mechanism of the ultrafast reversible photoreaction of visual pigment rhodopsin may serve as a concept for developing an ultrafast optical molecular switch. PMID: 25393597
  16. Formation and decay of the arrestin.rhodopsin complex in native disc membranes. PMID: 25847250
  17. Phospholipid scrambling is a constitutive activity of rhodopsin, distinct from its light-sensing function. PMID: 25296113
  18. Maps of information flow were calculated in A2 A adenosine receptor (A2 A AR) and bovine rhodopsin, identifying key residues for signal transduction and their pathways. PMID: 24166702
  19. One site on rhodopsin can interact with multiple structurally separate sites on arrestin that are almost 30 angstroms apart. PMID: 24724832
  20. A comparison of melanopsin with the documented mechanisms for vertebrate (bovine) and invertebrate (squid) visual photoreceptors indicates that this mechanism is not affected by the diversity of the three chromophore cavities. PMID: 24449866
  21. Retinitis pigmentosa mutants provide insight into the role of the N-terminal cap in rhodopsin folding, structure, and function. PMID: 24106275
  22. This study aimed to investigate the mechanisms by which the autosomal dominant rhodopsin mutation Ter349Glu causes early, rapid retinal degeneration. PMID: 23940033
  23. Findings demonstrate that a quantum chemical model of rhodopsin provides a molecular-level understanding of the Barlow correlation; the transition state mediating thermal activation has the same electronic structure as the photoreceptor excited state, creating a direct link between maximum absorption wavelength and thermal activation kinetic constant. PMID: 22955833
  24. Results describe the geometries, electronic effects, and vertical excitation energies in the dark state of mutated human and cattle rhodopsins carrying the abnormal substitutions M207R or S186W at the retinal binding pocket. PMID: 22126625
  25. The effects of inorganic salts on the thermal decay properties of both its inactive and photoactivated states on the alpha-helical membrane protein rhodopsin from vertebrate retina are reported. PMID: 22261069
  26. Expression of the human RHO P23H transgene in the retina creates a miniature swine model with an inheritance pattern and retinal function that mimics adRP. PMID: 22247487
  27. The glycosylation pattern in the serotonin receptor (5-HT4R) is more complex than in murine and bovine rhodopsin. PMID: 22145929
  28. The M257Y(6.40) constitutively active mutant of the photoreceptor rhodopsin was used in combination with the specific binding of a C-terminal fragment from the G protein alpha subunit (GalphaCT) to trap a light activated state for crystallization. PMID: 22198838
  29. Rhodopsin/transducin complex formation occurs only when rhodopsin is in the activated state. PMID: 21995315
  30. Conformational dynamics of helix 8 in the GPCR rhodopsin control arrestin activation in the desensitization process. PMID: 22039220
  31. Kinetic analysis of rhodopsin thermal decay reveals unusual energetics of thermal isomerization and Schiff base hydrolysis. PMID: 21921035
  32. Molecular mechanisms of disease for mutations at Gly-90 in rhodopsin. PMID: 21940625
  33. These results indicate that the bilayer structure increases the activation energy of rhodopsin denaturation. PMID: 21689528
  34. In the presence of antibodies against immune-dominant epitopes, recoverin loses its ability to function as a Ca(2+)-sensitive inhibitor of rhodopsin phosphorylation. PMID: 21568868
  35. Transfection of hTERT-RPE1 cells with constructs encoding RHO-EGFP, but not RHO-mCherry, results in the distribution of fluorescently-tagged opsin in the plasma membrane. PMID: 20238016
  36. The role of bulk water in the hydrolysis of the rhodopsin chromophore. PMID: 21460218
  37. A multiscale activation mechanism with a complex energy landscape, whereby the photonic energy is directed against the E2 loop by the C13-methyl group, and toward helices H3 and H5 by the C5-methyl of the beta-ionone ring. PMID: 21527723
  38. Solid-state (2)H NMR relaxation elucidates picosecond-to-nanosecond-timescale motions of the retinal ligand that influence larger-scale functional dynamics of rhodopsin in membranes. PMID: 21278756
  39. We hypothesize that, although arrestin requires at least a single Rho*P to bind the membrane, a single arrestin can actually interact with a pair of receptors. PMID: 21169358
  40. Analyses of the photobleaching processes of split rhodopsins and rhodopsin mutant lacking a disulfide bond demonstrate that the rigid structure of the second extracellular loop is necessary for facilitating the formation of the active state. PMID: 20886156
  41. Similar to transducin activation, rhodopsin phosphorylation by GRK1 and high-affinity arrestin-1 binding only require a rhodopsin monomer. PMID: 20966068
  42. Hydrophobic interactions mediated by V138(3).(3), V227.(2), V250.(3)(3), V254.(3), and I255.(3) are critical for receptor activation and/or efficient rhodopsin-transducin interaction. PMID: 21114958
  43. These data suggest that a larger conformational change in helices V and VI of bovine rhodopsin explains its greater G protein activation ability compared to other rhodopsins. PMID: 19497849
  44. Specific binding of rhodopsin-loaded nanoscale apolipoprotein bound bilayer particles to the surface and formation of a membrane protein monolayer. PMID: 20923668
  45. Both blue- and green-sensitive rod rhodopsins possess at least one allosteric binding site for retinoid, but beta-ionone binds to the latter type of rhodopsin with low affinity and efficacy. PMID: 20923672
  46. The amino acid residues that naturally differ between bovine and mouse rhodopsin appear to have minimal impact on molecular interactions stabilizing structural segments and unfolding intermediates; no major differences in unfolding energy are observed. PMID: 21038881
  47. Results indicate that the counterion does not need to be located at position 113 for high photosensitivity to natural light. This suggests that the counterion in vertebrate visual pigments is optimally positioned for the stability of the Schiff base linkage. PMID: 21038858
  48. The crystal structure of opsin in the region of the ionic lock reflects the active state of the receptor. PMID: 21041664
  49. The experiments highlight the importance of interactions between rhodopsin and specific lipid species in the first layer of lipids surrounding the protein, as well as membrane elastic stress in the lipid-protein domain. PMID: 20682259
  50. Ultrafast optical spectroscopy with sub-20-fs time resolution and spectral coverage from the visible to the near-infrared allows for tracking the dynamics leading to the conical intersection in rhodopsin isomerization. PMID: 20864998

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.
Tissue Specificity
Expressed in rod-shaped photoreceptor cells in the retina that mediate vision in dim light (at protein level).

Q&A

What is the basic structural composition of bovine rhodopsin?

Bovine rhodopsin consists of two primary components: a protein molecule called scotopsin and a covalently-bound cofactor called retinal. Scotopsin is an opsin—a light-sensitive G protein-coupled receptor (GPCR) that embeds in the lipid bilayer using seven protein transmembrane domains. These domains form a pocket where the photoreactive chromophore, retinal, lies horizontally to the cell membrane, linked to a lysine residue in the seventh transmembrane domain of the protein. Thousands of rhodopsin molecules are found in each outer segment disc of the host rod cell .

How does the structure of bovine rhodopsin enable its photosensitive function?

The photosensitivity of bovine rhodopsin arises from its ability to undergo significant conformational changes upon light absorption. When rhodopsin absorbs light, its retinal cofactor isomerizes from the 11-cis to the all-trans configuration. This isomerization triggers a series of protein relaxations to accommodate the altered shape of the cofactor .

The photoisomerization in bovine rhodopsin follows a defined pathway: light absorption leads first to the formation of photorhodopsin within 200 femtoseconds, followed by bathorhodopsin with distorted all-trans bonds. Subsequent intermediates include lumirhodopsin and metarhodopsin I, where the Schiff's base linkage remains protonated. The critical activation step occurs during the conversion of metarhodopsin I to metarhodopsin II, associated with deprotonation of the Schiff's base and color change from red to yellow .

What are the most effective methods for expressing recombinant bovine rhodopsin?

For effective expression of recombinant bovine rhodopsin, the preferred method involves using mammalian cell lines deficient in endogenous rhodopsin production. The expression protocol typically includes:

  • Transfection of mammalian cells with the bovine opsin gene construct

  • Cultivation of cells in appropriate growth medium with necessary supplements

  • Collection of cells by centrifugation

  • Homogenization in PBS buffer with protease inhibitors

The rhodopsin apoprotein is then solubilized using dodecyl maltoside (DDM) at a final concentration of 1.25% (w/v) with the cell suspension at 20% (w/v). After gentle stirring for 1-2 hours, the solubilized fraction is collected by centrifugation at 200,000×g for 1 hour .

What purification strategies yield the highest purity and functional activity for recombinant bovine rhodopsin?

For highest purity and functional activity, immunoaffinity chromatography using 1D4 antibody-coupled Sepharose beads has proven most effective. The protocol includes:

  • Capturing solubilized rhodopsin apoprotein in batch using immunoaffinity Sepharose beads coupled to 1D4 antibody (ratio: 5g cells per ml resin)

  • Collection and washing of the 1D4 resins with 10 column volumes of PBS containing 0.04% DDM

  • Resuspension of the resins in 2 column volumes of PBS with 0.04% DDM

  • Addition of 75 μM of either 9-cis or 11-cis retinal for at least 6 hours in dark conditions to form the functional rhodopsin

This method ensures both high purity and proper folding of the recombinant protein with appropriate retinal binding, which is essential for maintaining its photosensitive properties.

What spectroscopic methods are most informative for analyzing rhodopsin photochemistry?

Multiple spectroscopic techniques provide complementary information about rhodopsin photochemistry:

  • UV-Visible Absorption Spectroscopy: Monitors the characteristic absorption maxima of rhodopsin (approximately 500 nm) and tracks spectral shifts during photoactivation. Dark-state bovine rhodopsin shows absorption in the green-blue region, appearing reddish-purple (hence the name "visual purple") .

  • Time-Resolved IR Spectroscopy: Enables monitoring of structural changes in the femtosecond to picosecond timeframe during photoactivation.

  • Resonance Raman Spectroscopy: Particularly anti-Stokes resonance Raman spectroscopy has revealed that intermediates like the J intermediate represent vibrationally hot states of subsequent intermediates, with highly twisted and thermally excited chromophores .

  • Fourier-Transform Transient Absorption: With sub-5-femtosecond resolution, this technique has demonstrated that isomerization events occur within femtoseconds .

These techniques collectively reveal that the photoisomerization process follows an ultrafast ballistic barrierless wavepacket movement on the excited state surface, with evolution along multiple reaction coordinates .

How can researchers distinguish between different photointermediates in the rhodopsin photocycle?

Distinguishing between photointermediates requires careful spectroscopic analysis with precise temporal resolution:

  • Photorhodopsin: Forms within 200 femtoseconds after irradiation and can be detected using ultrafast spectroscopy techniques.

  • Bathorhodopsin: Forms within picoseconds and can be trapped and studied at cryogenic temperatures (initially called prelumirhodopsin).

  • Lumirhodopsin and Metarhodopsin I: Distinguished by their spectral properties while still maintaining a protonated Schiff's base and reddish color.

  • Metarhodopsin II: Identified by its deprotonated Schiff's base and yellow color .

For precise characterization, researchers should employ time-resolved spectroscopy with appropriate time windows ranging from femtoseconds to milliseconds. Temperature-dependent studies are also valuable, as some intermediates can be trapped and characterized at specific temperatures. Differential spectroscopy comparing sequential timepoints can highlight the specific spectral changes associated with each transition.

What methods best assess G protein coupling and activation by recombinant bovine rhodopsin?

Several approaches effectively assess G protein coupling and activation:

  • GTPγS Binding Assays: Measures the GDP/GTP exchange rate on G proteins upon rhodopsin activation using radiolabeled non-hydrolyzable GTP analogs.

  • BRET/FRET-Based Assays: Using fluorescently or bioluminescently labeled rhodopsin and G proteins to monitor protein-protein interactions and conformational changes in real-time.

  • Cryo-EM Structural Analysis: Provides detailed information about the binding interface between light-activated rhodopsin and the heterotrimeric G protein. Recent cryo-EM structures have revealed specific interactions between the receptor C-terminal tail and the Gβ subunit, and between intracellular loops 2 and 3 of rhodopsin and the Gα subunit .

For comprehensive analysis, researchers should combine functional assays with structural methods to correlate activity measurements with specific molecular interactions at the rhodopsin-G protein interface.

How do mutations in bovine rhodopsin affect its G protein coupling efficiency?

Mutations in bovine rhodopsin can significantly impact G protein coupling through several mechanisms:

  • Alterations in the C-terminal tail: Mutations affecting the C-terminal tail can disrupt critical interactions with the Gβ subunit of the G protein, reducing coupling efficiency .

  • Changes in intracellular loops: Modifications to ICL2 and ICL3 can alter their contacts with the Gα subunit, affecting the binding and activation processes .

  • Mutations near the chromophore binding pocket: These can lead to constitutive activation, as observed in conditions like X-linked congenital stationary night blindness .

Research has shown that disease-causing mutations can lead to protein aggregation with ubiquitin in inclusion bodies, disruption of the intermediate filament network, and impairment of the cell's ability to degrade non-functioning proteins, ultimately leading to photoreceptor apoptosis .

How does the electrostatic environment within rhodopsin modulate spectral tuning?

The spectral properties of rhodopsin are precisely modulated by its internal electrostatic environment through several mechanisms:

  • RSBH+ Counterion Interactions: The protonated retinal Schiff base (RSBH+) interacts with negatively charged counterion(s), leading to electrostatic stabilization in the electronic ground state. This stabilization increases the energy gap between ground and excited states, causing a blue-shift in absorption .

  • Charge Distribution Effects: The excited state of retinal has strong charge transfer character, with positive charge displacement toward the β-ionone ring. If negative charges are located near this ring, they stabilize the excited state, reducing the energy gap and creating a red-shift in absorption .

  • Hydrogen Bonding Networks: Strong hydrogen bonds can lead to charge transfer effects that influence the electronic structure of retinal.

  • Steric Interactions: Physical contacts within the binding pocket can induce twisting of the retinal molecule, affecting its conjugated π-electron system and altering absorption properties .

These tuning mechanisms collectively shape the absorbance maxima of rhodopsin, allowing precise spectral sensitivity.

What structural features distinguish type I and type II rhodopsins despite their similar functions?

Despite sharing the seven transmembrane α-helix GPCR fold and a Schiff base linkage from a conserved lysine to retinal, type I (microbial) and type II (animal) rhodopsins exhibit significant structural differences:

  • Sequence Divergence: The two rhodopsin families lack detectable sequence similarity, supporting the hypothesis of convergent evolution .

  • Retinal Configuration: Type I rhodopsins typically bind all-trans retinal, while type II rhodopsins bind 11-cis retinal .

  • Isomerization Site: The photoisomerization in animal rhodopsins occurs at the C11═C12 bond, whereas in microbial rhodopsins it occurs at the C13═C14 bond .

  • Protein-Chromophore Interactions: The specific amino acids and interaction networks stabilizing the chromophore differ between the two types.

  • Signaling Mechanisms: Type II rhodopsins couple to G proteins, while type I rhodopsins typically function as ion pumps, channels, or sensors without G protein involvement .

What techniques best capture the dynamic conformational changes during rhodopsin photoactivation?

Capturing the dynamic conformational changes in rhodopsin requires techniques with appropriate temporal and spatial resolution:

  • Time-Resolved X-ray Crystallography: Provides structural snapshots at different timepoints during the photocycle with atomic resolution.

  • Time-Resolved FTIR Spectroscopy: Identifies specific bond vibrations and changes in hydrogen bonding networks during activation.

  • Molecular Dynamics Simulations: Complements experimental techniques by modeling atomic movements between experimental timepoints.

  • Site-Directed Spin Labeling and EPR Spectroscopy: Monitors distances between specific residues during the activation process.

  • Time-Resolved Fluorescence Spectroscopy: Using strategically placed fluorophores to track relative movements of protein domains.

Research has shown that photoisomerization follows a defined sequence: bond length alternation along the retinal chain occurs first, followed by torsional rotation at specific double bonds. This movement leads to a conical intersection where the chromophore displays an approximately 90° twisted double bond configuration .

How do the dynamics of retinal isomerization differ between bovine rhodopsin and microbial rhodopsins?

The dynamics of retinal isomerization show both similarities and differences between bovine and microbial rhodopsins:

  • Isomerization Site: Bovine rhodopsin undergoes isomerization at the C11═C12 bond (11-cis to all-trans), while microbial rhodopsins typically isomerize at the C13═C14 bond (all-trans to 13-cis) .

  • Excited State Dynamics: Both systems show ultrafast ballistic barrierless wavepacket movement on the excited state surface, suggesting that the isomeric state of retinal may define the dynamics of the excited state rather than the protein environment .

  • Quantum Yield: Bovine rhodopsin shows extremely high quantum efficiency (0.67) and 100% selectivity for the 11-cis to all-trans isomerization .

  • Temporal Dynamics: In bovine rhodopsin, bathorhodopsin forms within 6 picoseconds after excitation at room temperature, while similar intermediates in microbial rhodopsins may form with slightly different kinetics .

  • Vibrational Coherence: Both systems demonstrate the importance of vibrational coherence in efficient excited-state photoisomerization, though the specific vibrational modes involved may differ .

How can recombinant bovine rhodopsin serve as a model system for studying other G protein-coupled receptors?

Recombinant bovine rhodopsin offers several advantages as a model system for studying GPCRs:

  • Stability and Expression: Rhodopsin can be expressed in relatively high quantities and purified in a stable form compared to many other GPCRs.

  • Light-Activated Control: Unlike many GPCRs that require diffusible ligands, rhodopsin can be precisely activated with light, allowing for exact temporal control of the activation process.

  • Structural Information: As one of the best-characterized GPCRs structurally, rhodopsin provides a foundation for understanding conformational changes and binding interfaces in the GPCR superfamily .

  • G Protein Interactions: Studies of rhodopsin-G protein complexes have revealed general principles about receptor-G protein coupling that likely apply to other GPCRs, including the role of the receptor C-terminal tail in binding to Gβ and the involvement of intracellular loops in Gα interactions .

Researchers studying other GPCRs can use insights from the rhodopsin system to guide their experimental design, particularly for understanding activation mechanisms and G protein coupling.

What can engineered rhodopsin variants teach us about the requirements for photosensitive function?

Engineered rhodopsin variants have provided critical insights challenging conventional views about structural requirements for photosensitivity:

  • Fold Modifications: Functional bacteriorhodopsin variants with novel folds, including radical noncircular permutations of the α-helices and circular permutations of eight-helix constructs, demonstrate that the canonical rhodopsin fold is not strictly required for photosensitive activity .

  • Retinal Linkage Relocation: Variants with retinal linkages relocated to other helices can maintain photosensitivity, showing flexibility in chromophore positioning .

  • Spectral Tuning: Engineered variants with modified electrostatic environments around the retinal binding pocket demonstrate how specific amino acid interactions can tune spectral properties. For example, modifications that change the electrostatic potential within the retinal-binding pocket can shift the absorption maximum from 425 to 644 nm .

These findings directly contradict a key prediction of convergent evolution theory and suggest that photosensitive function is more flexible and adaptable than previously thought, with multiple structural solutions capable of supporting similar functions.

How do rhodopsin mutations contribute to retinal diseases, and what models best study these mechanisms?

Rhodopsin mutations contribute to retinal diseases through several mechanisms:

  • Protein Aggregation: Disease-causing rhodopsin mutations often lead to protein aggregation with ubiquitin in inclusion bodies, disrupting cellular homeostasis .

  • Cytoskeletal Disruption: Mutant rhodopsins can disrupt the intermediate filament network within photoreceptor cells .

  • Protein Degradation Impairment: Mutations can impair the cell's ability to degrade non-functioning proteins through normal quality control mechanisms .

  • Constitutive Activation: Some mutations, particularly those around the chromophore binding pocket, lead to X-linked congenital stationary night blindness due to constitutive activation of the receptor .

  • Trafficking Defects: Other pathological states arise from poor post-Golgi trafficking of rhodopsin to the outer segments .

For studying these mechanisms, several model systems prove valuable:

  • Animal models: Transgenic mice expressing mutant rhodopsins

  • Cell culture systems: Expressing wild-type and mutant rhodopsins in appropriate cell lines

  • In vitro biochemical assays: Comparing stability and folding properties of purified wild-type and mutant proteins

  • Structural studies: Examining how mutations affect the three-dimensional structure and dynamics

What therapeutic approaches target rhodopsin misfolding in retinitis pigmentosa?

Several therapeutic approaches are being developed to address rhodopsin misfolding in retinitis pigmentosa:

  • Pharmacological Chaperones: Small molecules that stabilize the native conformation of rhodopsin and promote proper folding.

  • Gene Therapy Approaches:

    • Gene supplementation with wild-type rhodopsin

    • RNA interference to selectively suppress mutant rhodopsin expression

    • CRISPR/Cas9-based gene editing to correct mutations

  • Proteostasis Regulators: Compounds that modulate the cellular protein quality control machinery to enhance the degradation of misfolded rhodopsin or improve chaperone function.

  • Optogenetic Approaches: Bypassing defective rhodopsin by expressing other light-sensitive proteins in surviving retinal cells.

  • Cell Replacement Therapies: Transplantation of healthy photoreceptor precursors or stem cell-derived photoreceptors.

These approaches are at various stages of development, from preclinical testing to early clinical trials, with the goal of preserving photoreceptor function and survival in patients with rhodopsin-related retinal degeneration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.