Recombinant Bovine RING finger protein 112 (RNF112)

Shipped with Ice Packs
In Stock

Description

Biochemical Functions

RNF112 exhibits multiple conserved functionalities across species:

FunctionMechanism/Associated Proteins
Zinc ion bindingMediates structural stability and interaction with DNA/RNA
GTPase activityRegulates intracellular signaling pathways
Ubiquitin ligase activityFacilitates protein ubiquitination and degradation via E3 ligase activity

These functions enable roles in neuronal differentiation, cell cycle regulation, and embryonic development .

Developmental Roles

  • Embryonic Vascular Development: Knockout studies in mice revealed that Rnf112 deficiency causes embryonic lethality due to vascular defects, underscoring its role in angiogenesis .

  • Neurogenesis: Rnf112 promotes neuronal differentiation by inhibiting cell cycle progression, as demonstrated in vitro .

Interactions and Localization

  • RNF112 interacts with promyelocytic leukemia zinc finger (Plzf), altering its cellular localization from cytoplasm to nucleus and stabilizing Plzf protein levels .

Functional Impairments

  • Rnf112-deficient mice exhibit brain size reduction, motor imbalance, and memory deficits .

Applications in Research

  • Pathway Analysis: Used to study pathways like ubiquitination and GTPase signaling .

  • Neurodevelopmental Studies: Models RNF112’s role in brain function and disorders .

  • Protein Interaction Screens: Yeast two-hybrid systems identify binding partners like Plzf .

Comparative Insights

While most functional data derive from murine or human studies, bovine RNF112’s structural conservation suggests analogous roles. For example:

  • Human RNF112 is implicated in Smith-Magenis syndrome (chromosome 17) .

  • Murine Rnf112 regulates embryonic vasculogenesis and postnatal brain function .

Handling and Quality Control

  • Stability: Lyophilized powder retains activity for years at -80°C; avoid freeze-thaw cycles .

  • Activity Validation: Confirmed via SDS-PAGE and interaction assays .

Future Directions

Further studies should address:

  • Bovine-specific roles in agricultural models.

  • Structural characterization of the RING domain’s ubiquitination mechanics.

  • Therapeutic potential in neurodegenerative diseases.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RNF112; ZNF179; RING finger protein 112; Zinc finger protein 179
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-628
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
RNF112
Target Protein Sequence
MPRSALSVISFCHRLGKQERKRSFMGNSSNSWSHTPFPKLELGLGSRPTAPREPPACSIC LERPREPISLDCGHDFCPRCFSTHRVPGCGPPCCPECRKTCKRRKGLRGLGERMRLLPQR PLPAAALQETCAVRAEPLLLVRINASGGLILRMGAINRCLKHPLARDTPVCLLAVLGGPH SGKTFLLNHLLQGLPGLASGEGSWPRSAGSGQGFRWGANGLSRGIWMWSHPFLLGKEGRK VAVFLVDTGDVMSPELSRETRTRLCALTSMLSSYQILTASQELKDTDLEHLETFVHVAEV MGRHYGMVPIQHLDLLVRDSSHPSKAWQGHVGDVIQKSSGKYPKVQGLLQGRRARCYLLP APGRRWASRGHGSSGDDDAGRLRAYVADVLSAAPQHAKSRCPGYWSEGRPAARGDRRLLT GQQLAQEVKNLSGWMGRTGPSCASPDEMAAQLHDLRTVEAAKKEFEEYVRQQDAATKRIF SALRVLPDTMRNLLSAQKDTLLARHGATLLCTGREQTLEALEAELQAEAKAFMDSYTVRF CGHLAAVGGAVGAGLMGLAGGVVGAGMAAAALAAEAGMVAAGAAVGATGAAVVGGGVGAG LAATVGCMEKEEDERVQEGDREPLLQEE
Uniprot No.

Target Background

Function
RING finger protein 112 (RNF112) is an E3 ubiquitin-protein ligase that plays a crucial role in neuronal differentiation, including neurogenesis and gliogenesis, during brain development. During embryonic development, it initiates neuronal differentiation by inducing cell cycle arrest at the G0/G1 phase through up-regulation of cell-cycle regulatory proteins. RNF112 is not only involved in the fetal period during nervous system development but also plays a role in the adult brain, where it contributes to the maintenance of neural functions and protects nervous tissue cells from oxidative stress-induced damage. RNF112 exhibits GTPase and E3 ubiquitin-protein ligase activities. It regulates dendritic spine density and synaptic neurotransmission; its ability to hydrolyze GTP is essential for maintaining dendritic spine density.
Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Membrane; Peripheral membrane protein. Cytoplasm. Nucleus. Nucleus, nuclear body. Nucleus, nucleoplasm. Endosome. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Cell junction, synapse, postsynaptic density. Perikaryon. Cell projection, neuron projection.

Q&A

What is the optimal expression system for recombinant bovine RNF112?

Recombinant bovine RNF112 can be expressed in multiple systems, each with distinct advantages depending on your experimental requirements. E. coli expression systems are often used for high yield and cost-effectiveness, particularly suitable for structural studies . For applications requiring post-translational modifications, mammalian expression systems such as HEK-293 cells are preferred, as they maintain proper protein folding and modification patterns .

For E. coli expression, optimization of induction temperature (typically 16-25°C) and IPTG concentration (0.1-0.5 mM) can significantly improve soluble protein yield. When using mammalian systems, transient transfection followed by selection can generate stable cell lines for consistent protein production. Based on homology with human and rat RNF112, the full-length bovine protein is expected to be approximately 631 amino acids .

What purification strategies yield the highest purity for recombinant bovine RNF112?

A multi-step purification approach is recommended for obtaining high-purity recombinant bovine RNF112. Initial capture via affinity chromatography using N-terminal or C-terminal tags (His, Strep, or GST) provides efficient first-step purification . For His-tagged bovine RNF112, Ni-NTA or TALON resin under native conditions (pH 7.4-8.0) with imidazole gradient elution (20-250 mM) significantly reduces non-specific binding.

Secondary purification steps should include ion-exchange chromatography followed by size-exclusion chromatography to achieve >90% purity as determined by SDS-PAGE and Western blot analysis . Protein quality should be assessed by analytical SEC (HPLC) to confirm monomeric state and absence of aggregates. Based on recombinant RNF112 from other species, expected purity levels of >90% are achievable with this approach .

What are the optimal storage conditions for maintaining RNF112 stability and activity?

To maintain structural integrity and functional activity, purified bovine RNF112 should be stored in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose as a cryoprotectant . For long-term storage, add glycerol to a final concentration of 20-50% and store at -80°C in small aliquots to prevent freeze-thaw cycles . Studies with rat RNF112 indicate that repeated freeze-thaw cycles significantly reduce protein activity.

Prior to experimentation, centrifuge thawed protein briefly to concentrate any precipitate, and reconstitute lyophilized protein to 0.1-1.0 mg/mL in deionized sterile water. Working aliquots can be maintained at 4°C for up to one week, but functionality should be verified before critical experiments . Activity assays specific to E3 ubiquitin ligase function are recommended to confirm protein quality after storage.

How can the E3 ubiquitin ligase activity of bovine RNF112 be effectively measured in vitro?

The E3 ubiquitin ligase activity of bovine RNF112 can be assessed through in vitro ubiquitination assays. Based on research with human RNF112, a complete reaction mixture should contain purified recombinant RNF112, ATP regeneration system (2 mM ATP, 10 mM creatine phosphate, 3.5 U/mL creatine kinase), E1 enzyme (100 nM), E2 enzyme panel (250 nM each), and ubiquitin (5 μM) .

Reactions should be incubated at 30°C for 60-90 minutes and terminated with SDS sample buffer containing β-mercaptoethanol. Ubiquitination can be detected by Western blotting using anti-ubiquitin antibodies. For substrate-specific ubiquitination assays, include purified substrates (e.g., FOXM1) and detect polyubiquitination using substrate-specific antibodies . Control reactions omitting ATP, E1, E2, or RNF112 are essential to confirm specificity of the reaction.

What protein interactions have been identified for RNF112, and how might these be conserved in bovine variants?

RNF112 interacts with multiple proteins across species, with FOXM1 being a well-characterized binding partner. Co-immunoprecipitation and GST pull-down assays have confirmed direct interaction between RNF112 and FOXM1, with the N-terminus of RNF112 (amino acids 1-147) interacting with the DNA binding domain of FOXM1 (amino acids 235-347) .

Immunofluorescence analysis has shown that RNF112 and FOXM1 predominantly colocalize in the cytoplasm, with minor colocalization observed in the nucleus . This interaction is functionally significant, as RNF112 mediates FOXM1 ubiquitination, leading to its degradation. Given the high conservation of functional domains across mammalian species, bovine RNF112 is expected to maintain similar interaction patterns, particularly within the N-terminal region responsible for substrate recognition.

RNF112 DomainInteracting PartnerFunctional OutcomeDetection Method
N-terminus (1-147 aa)FOXM1 (DNA binding domain, 235-347 aa)Increased FOXM1 ubiquitination and degradationCo-IP, GST pull-down, Immunofluorescence
RING finger domainE2 conjugating enzymesFacilitates ubiquitin transferIn vitro ubiquitination assay

How does RNF112 expression affect downstream cellular pathways?

RNF112 expression significantly impacts multiple cellular pathways through its regulatory effects on transcription factors like FOXM1. Gene set enrichment analysis has revealed that high RNF112 expression correlates with inhibition of pathways associated with cell cycle progression and proliferation (DNA repair, E2F targets, G2M checkpoint) . Additionally, pathways related to cell migration and invasion (mTORC1 signaling, Myc targets) are suppressed in cells with elevated RNF112 levels .

At the molecular level, RNF112 negatively regulates FOXM1 target genes including CKS1, CCNB1, SKP2, FN1, and ZEB1, as demonstrated by luciferase reporter assays . These effects translate to functional outcomes in cellular and animal models, where RNF112 overexpression reduces tumor growth, weight, and metastatic potential . When designing experiments with bovine RNF112, researchers should consider monitoring these downstream targets as functional readouts of RNF112 activity.

What controls are essential when evaluating bovine RNF112 function in experimental settings?

Comprehensive control strategies are crucial for accurately interpreting bovine RNF112 functional studies. For protein interaction experiments, include:

  • Negative controls: Catalytically inactive RNF112 mutants (mutations in the RING domain) to distinguish between binding and enzymatic functions

  • Specificity controls: Unrelated proteins with similar structural features to rule out non-specific interactions

  • Domain-specific controls: Truncated variants of RNF112 lacking specific domains to map interaction regions

For ubiquitination assays, essential controls include reactions lacking E1, E2, ATP, or ubiquitin to confirm reaction specificity. When expressing RNF112 in cellular systems, compare with empty vector controls and utilize both overexpression and knockdown approaches to establish causality. Additionally, species-matched controls should be included when comparing bovine RNF112 with orthologs from other species to account for sequence variations.

How can researchers effectively address cross-species variations when working with bovine RNF112?

When studying bovine RNF112, accounting for species-specific variations is essential for accurate data interpretation. Sequence alignment analysis comparing bovine RNF112 with human, mouse, and rat orthologs reveals highest conservation in functional domains, particularly the RING finger domain and N-terminal interaction regions .

For antibody-based applications, epitope mapping is crucial to ensure recognition of bovine-specific sequences. When designing primers for cloning or qPCR, target highly conserved regions while accounting for codon usage bias in bovine systems. Heterologous expression experiments should include species-matched positive controls, and functional complementation assays can determine whether bovine RNF112 can rescue phenotypes in cells lacking endogenous RNF112 from other species.

For binding studies with putative interaction partners, it is advisable to use both bovine-derived proteins and orthologs from other species to identify any species-specific interaction differences that might have functional implications.

How can CRISPR-Cas9 gene editing be optimized for studying bovine RNF112 function?

CRISPR-Cas9 approaches for editing bovine RNF112 require careful design considerations:

  • Guide RNA selection: Design multiple sgRNAs targeting conserved exons, particularly those encoding the RING domain (amino acids approximately 40-90 based on homology with human and rat RNF112) . Validate guide efficiency using in silico prediction tools and T7 endonuclease assays.

  • Editing strategy selection: For complete knockout, target early exons to induce frameshift mutations. For domain-specific studies, design paired guides to excise specific functional regions. For knock-in applications (e.g., fluorescent tags), incorporate homology arms of 800-1000bp and select insertion sites that minimize disruption of functional domains.

  • Delivery optimization: For bovine cell lines, nucleofection typically yields higher efficiency than lipid-based transfection. Ribonucleoprotein (RNP) complex delivery reduces off-target effects compared to plasmid-based approaches.

  • Validation approaches: Confirm editing by sequencing, Western blot, and functional assays (ubiquitination activity). Complementation with wild-type bovine RNF112 should rescue phenotypes in knockout cells to confirm specificity.

What are the most effective approaches for studying RNF112 substrate specificity beyond FOXM1?

To identify novel substrates of bovine RNF112 beyond the established FOXM1 interaction, a multi-faceted approach is recommended:

  • Proximity-based labeling: BioID or TurboID fusion with RNF112 enables identification of proximal proteins in living cells. Express RNF112-BioID in bovine cells, supply biotin, and identify biotinylated proteins by mass spectrometry.

  • Ubiquitinome analysis: Compare the ubiquitinated proteome in cells with and without RNF112 using diGly-remnant antibody enrichment followed by quantitative mass spectrometry. Proteins showing increased ubiquitination in RNF112-expressing cells represent potential substrates.

  • Domain-based interaction screening: Using the established N-terminal interaction domain of RNF112 (amino acids 1-147) as bait, perform yeast two-hybrid or mammalian two-hybrid screening to identify interacting partners .

  • Validation methods: Confirm direct interactions by reciprocal co-immunoprecipitation and in vitro ubiquitination assays. Functional validation should include monitoring substrate levels upon RNF112 manipulation and identifying ubiquitination sites by mass spectrometry.

How does bovine RNF112 expression vary across different tissues and developmental stages?

While specific data on bovine RNF112 tissue distribution is limited, insights from other species suggest tissue-specific expression patterns that may be conserved in bovine systems. Based on its alternate name "Brain finger protein," RNF112 likely shows enriched expression in neural tissues .

To characterize bovine RNF112 expression:

  • Tissue profiling: Perform qRT-PCR and Western blot analysis across a panel of bovine tissues, with particular attention to brain regions, reproductive tissues, and digestive system. Compare with publicly available RNA-seq datasets from bovine tissue repositories.

  • Developmental profiling: Analyze RNF112 expression at different embryonic stages and postnatal timepoints to identify temporal regulation patterns.

  • Single-cell approaches: For heterogeneous tissues like brain, single-cell RNA-seq can identify cell type-specific expression patterns that may reveal specialized functions.

  • Regulatory analysis: Characterize the bovine RNF112 promoter region to identify tissue-specific transcription factor binding sites that may explain differential expression patterns.

What strategies can resolve poor solubility of recombinant bovine RNF112?

Poor solubility is a common challenge when expressing full-length RNF112. Based on experiences with rat and human RNF112, the following strategies can improve solubility of bovine orthologs:

  • Expression conditions optimization: Lower induction temperature (16°C), reduce IPTG concentration (0.1 mM), and extend expression time (16-18 hours) to promote proper folding in bacterial systems .

  • Buffer optimization: Include solubility enhancers such as 10% glycerol, 0.1% NP-40, or 0.5M arginine in lysis and purification buffers. Tris/PBS-based buffers at pH 8.0 have shown effectiveness for rat RNF112 .

  • Fusion tags selection: N-terminal solubility tags such as SUMO, MBP, or GST can significantly improve folding and solubility compared to His tag alone .

  • Domain-based approach: Express functional domains (e.g., RING domain or N-terminal region) separately if full-length protein remains insoluble .

  • Expression system selection: Consider mammalian expression systems (HEK-293) or cell-free protein synthesis if bacterial expression continues to yield insoluble protein .

How can inconsistent results in RNF112 ubiquitination assays be addressed?

Inconsistent ubiquitination assay results often stem from several factors that can be systematically addressed:

  • E2 enzyme compatibility: Screen multiple E2 conjugating enzymes (UBE2D1-4, UBE2E1-3) as RNF112 may exhibit E2 preference that impacts activity .

  • Protein quality assessment: Verify RNF112 integrity by analytical SEC and thermal shift assays before functional testing. Aggregation or misfolding significantly impacts enzymatic activity.

  • Reaction conditions optimization: Systematically vary buffer conditions (pH 7.0-8.5), salt concentration (50-150 mM NaCl), and reaction temperature (25-37°C) to identify optimal parameters.

  • Substrate preparation: Ensure substrates like FOXM1 maintain native conformation, as denatured substrates may present cryptic ubiquitination sites leading to artifactual results .

  • Detection method selection: For challenging substrates, consider using ubiquitin variants with fluorescent or radioactive labels to increase sensitivity compared to traditional Western blotting.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.