Recombinant Bovine RING finger protein 183 (RNF183)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RNF183; E3 ubiquitin-protein ligase RNF183
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
RNF183
Target Protein Sequence
MAEQQGREPECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHISLVTPTRRRLLCPLCRHP TVLASGQPVTDLPTDTAVLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDLGP EPASQAGQPQDVGPSTRPVPIRSRYSLRECFRNPHFRIFAYMMAVILCGTVLFIFSIFCT RRFFWGVG
Uniprot No.

Target Background

Function

Recombinant Bovine RING finger protein 183 (RNF183) functions as an E3 ubiquitin ligase, catalyzing the covalent attachment of ubiquitin to substrate proteins. It triggers apoptosis in response to prolonged endoplasmic reticulum (ER) stress by mediating the polyubiquitination and subsequent proteasomal degradation of BCL2L1. RNF183 may also collaborate with FATE1 to regulate apoptotic signaling by controlling BIK protein levels.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Endoplasmic reticulum. Golgi apparatus, cis-Golgi network membrane. Lysosome.

Q&A

What is the basic structural organization of RNF183 protein?

RNF183 belongs to the RNF183 family, which includes RNF182, RNF186, and RNF152. These proteins share a similar structure with a RING finger domain (C3HC4) at their N-terminus and transmembrane domains at their C-terminus with high homology . The RING finger domain contains a novel consensus motif of cysteines and histidines that is essential for its E3 ligase activity.

What is the primary cellular function of RNF183?

RNF183 primarily functions as an E3 ubiquitin ligase in the protein ubiquitination pathway. This process involves the coordinated action of three enzymes: ubiquitin activating enzyme (E1), ubiquitin conjugating enzyme (E2), and ubiquitin ligase (E3) . As an E3 ligase, RNF183 determines the specificity of ubiquitination by binding to both the ubiquitinated E2 and a substrate protein, facilitating the transfer of ubiquitin from E2 to the substrate . RNF183 predominantly mediates K63-linked polyubiquitination, which is associated with lysosomal degradation rather than proteasomal degradation .

How is RNF183 expression regulated in normal tissue?

RNF183 expression is tightly regulated under physiological conditions. One key regulatory mechanism involves microRNA-7 (miR-7), which negatively regulates RNF183 expression . Under normal conditions, RNF183 expression is generally low in most tissues, but it can be significantly upregulated in response to specific stimuli such as inflammatory conditions or cellular stress .

How does RNF183 contribute to inflammatory bowel disease pathogenesis?

RNF183 plays a crucial role in promoting intestinal inflammation through the NF-κB signaling pathway. It specifically increases the ubiquitination and degradation of IκBα, an inhibitor of NF-κB, thereby promoting NF-κB activation and subsequent inflammatory responses . In IBD patients and experimental colitis models, RNF183 is significantly upregulated in intestinal epithelial cells. The miR-7/RNF183/IκBα axis represents a novel epigenetic mechanism in IBD pathogenesis, where decreased miR-7 expression leads to increased RNF183 levels, enhanced IκBα degradation, and sustained inflammatory responses .

What is known about RNF183's role in cancer biology?

RNF183 has been identified as a potential biomarker for endometrial cancer through gene expression screening . Analysis of endometrial cancer samples indicates that RNF183 is upregulated and exhibits higher expression in endometrioid, low-grade, and TP53-Non-Mutant samples . Interestingly, RNF183 expression is negatively correlated with tumor purity and the infiltrating levels of various immune cells, including CD4+ T cells . While RNF183 amplification appears to be associated with early-stage endometrial cancer, the exact molecular mechanisms underlying its contribution to cancer development require further investigation.

What is the relationship between RNF183 and death receptor pathways?

Research has demonstrated that RNF183 interacts with and ubiquitinates death receptor 5 (DR5) . This interaction specifically involves K63-linked polyubiquitination rather than K48-linked chains, suggesting that RNF183 targets DR5 for lysosomal degradation rather than proteasomal degradation . This finding distinguishes RNF183 from its closely related family member RNF182, which is unable to ubiquitinate DR5 . The regulation of death receptor pathways by RNF183 may have significant implications for understanding apoptosis resistance in inflammatory and neoplastic conditions.

What are the optimal approaches for studying RNF183 expression in tissue samples?

For measuring RNF183 expression in tissue samples, a multi-modal approach is recommended:

  • Quantitative RT-PCR: Useful for measuring mRNA levels of RNF183 in tissue samples. In studies of inflammatory bowel disease, qRT-PCR has successfully detected upregulation of RNF183 in intestinal tissues from IBD patients and colitic mice .

  • Western Blotting: For protein-level detection, western blotting with specific antibodies against RNF183 provides information about total protein levels and potential post-translational modifications.

  • Immunohistochemistry: This technique allows visualization of RNF183 expression patterns within tissue architecture, helping to identify specific cell types expressing the protein. This approach has been valuable in demonstrating that RNF183 is upregulated specifically in intestinal epithelial cells in IBD patients .

  • Genomic Microarray Analysis: For broader screening, microarray analysis can identify RNF183 upregulation in the context of global gene expression changes, as demonstrated in studies of inflamed colon samples from Crohn's disease patients .

What methods are effective for investigating RNF183's E3 ligase activity?

To study the E3 ligase activity of RNF183, researchers should consider the following methodologies:

  • In vitro Ubiquitination Assays: Using purified recombinant RNF183 protein along with E1, E2 enzymes, ubiquitin, ATP, and potential substrate proteins to directly assess ubiquitination activity.

  • Ubiquitination Analysis in Cell Systems: This involves:

    • Transfection of HA-tagged ubiquitin into cells expressing RNF183

    • Treatment with proteasome inhibitors (MG132) or lysosome inhibitors (chloroquine) to prevent degradation of ubiquitinated proteins

    • Immunoprecipitation of target proteins (such as DR5) followed by western blotting for ubiquitin

  • K63 vs. K48 Ubiquitin Chain Analysis: Using mutant ubiquitins that can form only K63 or K48 chains (with other lysines mutated to arginines) to determine the type of ubiquitin chains formed by RNF183 .

  • Tandem Ubiquitin Binding Entity (TUBE) System: This system can be employed to isolate specific types of polyubiquitinated proteins (e.g., K63-linked) from cells expressing wild-type or mutant RNF183 .

How can protein-protein interactions of RNF183 be effectively studied?

Several complementary approaches can be used to investigate RNF183's interactions with other proteins:

  • Co-immunoprecipitation (Co-IP): This technique has been successfully used to demonstrate the interaction between exogenously expressed RNF183 and endogenous DR5 . It involves:

    • Expression of tagged RNF183 in cell systems

    • Immunoprecipitation using antibodies against the tag or against RNF183

    • Western blotting for potential interacting proteins

  • Yeast Two-Hybrid (Y2H) Analysis: This approach has been used to screen for potential interacting partners of RING finger proteins and could be applied to RNF183.

  • Bimolecular Fluorescence Complementation (BiFC) Assays: This visual method can confirm protein interactions in living cells and provide information about the subcellular localization of these interactions.

  • Protein-Protein Interaction (PPI) Network Analysis: Computational approaches like those used in the GeneMANIA platform can help predict functional relationships between RNF183 and other proteins based on existing genomic and proteomic data .

How can RNF183 function be modeled in experimental systems?

Several experimental models have proven valuable for studying RNF183 function:

What are the potential therapeutic implications of targeting RNF183?

Based on its roles in inflammation and cancer, RNF183 represents a potential therapeutic target:

  • For Inflammatory Bowel Disease: Targeting the miR-7/RNF183/IκBα axis could provide a novel therapeutic approach for IBD. Strategies might include:

    • miR-7 mimics to downregulate RNF183 expression

    • Small molecule inhibitors of RNF183's E3 ligase activity

    • Peptide inhibitors that disrupt the interaction between RNF183 and IκBα

  • For Cancer Therapy: The role of RNF183 in endometrial cancer suggests potential applications in cancer treatment:

    • Biomarker development for cancer prognosis

    • Combination therapies targeting RNF183 and related signaling pathways

    • Immunotherapy approaches considering RNF183's relationship with tumor immune infiltration

  • Considerations for Drug Development: When designing RNF183-targeting therapeutics, researchers should consider:

    • Tissue specificity to minimize off-target effects

    • The impact on normal physiological processes that require RNF183

    • Potential differences between bovine and human RNF183 that might affect translational research

How can researchers address the challenges of RNF183 protein expression and purification?

Obtaining pure, functional RNF183 protein can be challenging due to its transmembrane domains. Recommended approaches include:

  • Expression Systems:

    • Prokaryotic systems (E. coli) for the RING finger domain alone

    • Eukaryotic systems (insect cells, mammalian cells) for full-length protein with proper folding and post-translational modifications

  • Solubilization Strategies:

    • Use of mild detergents for membrane protein extraction

    • Creation of fusion proteins to enhance solubility

    • Expression of truncated versions lacking the transmembrane domain

  • Purification Considerations:

    • Affinity tags (His, GST) positioned to avoid interference with the RING domain

    • Size exclusion chromatography to ensure protein quality

    • Activity assays to confirm functional integrity of the purified protein

What controls are essential for validating RNF183 ubiquitination experiments?

To ensure the reliability of ubiquitination studies involving RNF183, several controls are critical:

  • Negative Controls:

    • Catalytically inactive RNF183 mutants (e.g., point mutations in the RING domain's consensus cysteines)

    • Related E3 ligases that do not ubiquitinate the substrate of interest (e.g., RNF182 as a control for DR5 ubiquitination)

  • Specificity Controls:

    • K48 vs. K63 ubiquitin chain formation analysis using ubiquitin mutants

    • Comparison of effects between proteasome inhibitors (MG132) and lysosome inhibitors (chloroquine)

  • Expression Level Considerations:

    • Use of physiological expression levels to avoid artifacts from overexpression

    • Inducible expression systems to control timing and level of expression

  • Validation Across Systems:

    • Confirmation of in vitro findings in cell-based systems

    • Translation of cell culture results to animal models where possible

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.