Recombinant Bovine RING finger protein 186 (RNF186)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RNF186; E3 ubiquitin-protein ligase RNF186; RING finger protein 186
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
RNF186
Target Protein Sequence
MACLEIPQQPQLVCQKATPSDPAGCDGGPGGPTEGDLECLVCREPYSGVRPPKLLGCQHA FCAVCLKLLLCVQDDAWSIPCPLCRKVTAVPGGLVCTLRDQEKVLERLARPGLEVPLRPQ GLANPATLTAGQPREAGEEEQDAVTTNRAAARRLAAHLLLLVLLIILILPFIYPGVIRWV LSFLETLALLLALLFCSHPGQQDGCMPTPRTLFCRERKPSEIASIS
Uniprot No.

Target Background

Function
Recombinant Bovine RING finger protein 186 (RNF186) is an E3 ubiquitin protein ligase involved in an apoptotic signaling pathway triggered by endoplasmic reticulum stress. It stimulates the expression of unfolded protein response (UPR)-specific proteins, ubiquitinates BNIP1, regulates its mitochondrial localization, and induces calcium release from the endoplasmic reticulum, ultimately leading to apoptosis.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of RNF186 in mammalian cells?

RNF186 functions as an E3 ubiquitin-protein ligase with critical roles in both innate immunity and autophagy regulation. In macrophages, RNF186 promotes outcomes downstream of pattern recognition receptors (PRRs) responding to microbial products, contributing to assembly and ubiquitination of signaling complexes . In colonic epithelial cells, RNF186 regulates autophagy activation and intestinal homeostasis by acting as an E3 ubiquitin-protein ligase for EPHB2, which upon stimulation by its ligand EFNB1 (ephrin B1), becomes ubiquitinated at Lys892 and recruits MAP1LC3B to initiate autophagy processes . These dual roles highlight RNF186's importance in maintaining cellular homeostasis and immune function across different cell types.

How is RNF186 expression regulated in different cell types?

RNF186 expression demonstrates cell-type specificity and stimulus-dependent regulation. In human monocyte-derived macrophages (MDMs), RNF186 expression increases upon NOD2 stimulation, with protein levels peaking after 12-24 hours of stimulation . This regulation occurs at the transcriptional level. Similarly, exposure to live bacteria also increases RNF186 expression in MDMs . Importantly, RNF186's regulatory impact on autophagy appears to be tissue-specific - studies show that while RNF186 deficiency significantly decreases autophagy markers in colonic epithelial cells, no significant differences were observed in kidney epithelial cells between wild-type and RNF186-deficient mice . This suggests that the protein's expression and function are highly context-dependent.

What experimental models are most appropriate for studying bovine RNF186 function?

For studying bovine RNF186, researchers should consider both in vitro and in vivo approaches that parallel successful human and murine RNF186 studies. Cell culture models using bovine intestinal epithelial cells and bovine macrophages would provide insights into cell-type specific functions. Techniques that have proven effective include RNA interference (siRNA knockdown), CRISPR-Cas9 gene editing for generating knockout cell lines, and overexpression of wild-type or mutant RNF186 variants . For in vivo studies, mouse models with intestinal inflammation (such as DSS-induced colitis) have demonstrated RNF186's functional importance . Researchers could develop similar bovine intestinal organoid models or consider xenograft approaches using bovine cells in immunodeficient mice. Flow cytometry, Western blotting, and co-immunoprecipitation studies have been effective in tracking RNF186 expression, protein interactions, and downstream signaling events .

How can I validate RNF186 antibody specificity for bovine studies?

Validating antibody specificity for bovine RNF186 requires multiple complementary approaches. First, perform sequence alignment analysis between human, mouse, and bovine RNF186 to identify conserved regions that commercially available antibodies target. Conduct Western blot analysis using positive controls (cells overexpressing tagged bovine RNF186) alongside negative controls (RNF186 knockout cells generated via CRISPR-Cas9). Observe for a single band at the expected molecular weight (~18-20 kDa). Additionally, validate via immunoprecipitation followed by mass spectrometry to confirm the precipitated protein is indeed RNF186. For immunofluorescence applications, compare staining patterns in wild-type versus knockout cells, and perform competitive blocking with recombinant bovine RNF186 protein. Cross-reactivity testing with other RING finger proteins would further establish specificity. Finally, siRNA knockdown of RNF186 should result in proportional decrease in signal intensity across all validation methods.

How do the E3 ligase functional domains of RNF186 influence its substrate specificity?

The E3 ligase activity of RNF186 is essential for its function, with the zinc finger domain playing a crucial role in substrate recognition and ubiquitination. Studies demonstrate that the zinc finger domain of RNF186 is necessary for interactions with substrates like EPHB2 in epithelial cells and RIP2 in macrophages . When this domain is deleted or mutated (RNF186-ΔZnF), RNF186 loses its ability to enhance NOD2-induced ubiquitination of the RIP2-associated complex . Similarly, the zinc finger domain is critical for EPHB2 ubiquitination at Lys892, which subsequently promotes autophagy . Disease-associated variants provide further insights into domain function - the UC-risk variant RNF186 A64T shows decreased interaction with EPHB2 and reduced E3 catalytic ability, while the UC-protective variant RNF186 R179X demonstrates increased EPHB2 interaction . These findings suggest that the precise structural conformation of RNF186's functional domains determines not only binding capacity but also the efficiency of ubiquitin transfer to specific substrates.

What are the differences in RNF186-mediated signaling pathways between bovine macrophages and epithelial cells?

While the search results don't specifically address bovine cells, the differential functions of RNF186 in human macrophages versus epithelial cells provide a framework for investigating potential differences in bovine cell types. In macrophages, RNF186 primarily regulates innate immune signaling through pattern recognition receptors (PRRs), including NOD2, by promoting the assembly and ubiquitination of signaling complexes including RIP2, IRAK1, and TRAF6 . This leads to activation of MAPK and NFκB pathways, resulting in cytokine production and antimicrobial responses . In contrast, in epithelial cells, RNF186 functions in the EFNB1-EPHB2 signaling axis to regulate autophagy by mediating the ubiquitination of EPHB2 at Lys892, which enables MAP1LC3B recruitment for autophagosome formation . Researchers investigating bovine systems should examine whether these cell-type specific functions are conserved and how they might be influenced by species-specific differences in signaling intermediates or regulatory mechanisms.

How do rare and common RNF186 genetic variants influence protein function and disease susceptibility?

Both rare and common genetic variants in RNF186 influence protein function through distinct mechanisms, ultimately affecting disease susceptibility. The rare variant RNF186-A64T, associated with increased UC risk, demonstrates impaired ubiquitination capacity and reduced interaction with its substrate EPHB2 . Functionally, cells expressing this variant show compromised bacterial clearance, similar to RNF186-deficient cells . In contrast, the rare variant RNF186-R179X confers protection against UC and demonstrates enhanced interaction with EPHB2, suggesting a gain-of-function phenotype in terms of autophagy regulation and bacterial clearance . Common variants, such as the rs6426833 risk allele, operate through a different mechanism by reducing RNF186 expression levels rather than altering protein function directly . Macrophages from individuals carrying the rs6426833 risk allele (AA) show decreased baseline and particularly reduced NOD2-induced RNF186 expression at both mRNA and protein levels . Both mechanisms - functional impairment (rare variants) and reduced expression (common variants) - ultimately result in compromised RNF186-dependent outcomes in PRR signaling and autophagy regulation.

What is the molecular mechanism by which RNF186 regulates autophagy in intestinal epithelial cells?

RNF186 regulates autophagy in intestinal epithelial cells through a clearly defined molecular pathway involving EFNB1-EPHB2 signaling. The process begins when the ligand EFNB1 (ephrin B1) binds to its receptor EPHB2, triggering RNF186 to ubiquitinate EPHB2 specifically at lysine 892 (Lys892) . This ubiquitination creates a binding site for MAP1LC3B, a key component of autophagosome formation . The importance of this pathway is demonstrated by several observations: First, RNF186 knockout in colonic epithelial cell lines (Ls174t and Caco2) results in decreased MAP1LC3B-II levels and increased SQSTM1 (p62) accumulation, indicating reduced autophagy . Second, electron microscopy confirms decreased autophagosome formation in RNF186-deficient cells . Third, treatment with chloroquine (a lysosome inhibitor) reveals that RNF186 primarily functions in autophagy induction rather than affecting degradation pathways . The functional relevance of this mechanism is evident in bacterial clearance assays, where RNF186 deficiency or expression of the UC-associated A64T variant results in impaired intracellular bacterial elimination .

What are the optimal conditions for expressing and purifying recombinant bovine RNF186?

For optimal expression and purification of recombinant bovine RNF186, researchers should consider several key factors. First, select an expression system that maintains protein solubility and preserves E3 ligase activity - mammalian expression systems (HEK293T cells) have proven effective for human RNF186 studies and would likely be suitable for bovine RNF186 . Use a dual tag approach with an N-terminal His6 tag for initial purification and a C-terminal FLAG or Strep tag for secondary affinity purification, but avoid tags that might interfere with the zinc finger domain. Express the protein at lower temperatures (16-18°C) to enhance proper folding. Include zinc in the buffer system (10-50 μM ZnCl2) to maintain structural integrity of the zinc finger domain. For purification, use a staged approach beginning with immobilized metal affinity chromatography followed by size exclusion chromatography to separate monomeric from aggregated forms. Critical buffer components should include reducing agents (1-5 mM DTT or TCEP) to maintain cysteine residues, and protease inhibitors to prevent degradation. Validate the purified protein's activity through in vitro ubiquitination assays using known substrates like EPHB2 or RIP2.

What controls should be included when studying RNF186-mediated ubiquitination?

When studying RNF186-mediated ubiquitination, comprehensive controls are essential for accurate interpretation. For positive controls, include a well-characterized E3 ligase such as TRAF6 along with its known substrate to validate the ubiquitination assay system . Essential negative controls include: (1) a catalytically inactive RNF186 mutant with zinc finger domain deletion (RNF186-ΔZnF) which has been shown to abolish ubiquitination activity , (2) a system lacking E1 or E2 enzymes to confirm the specificity of the ubiquitination reaction, and (3) a substrate mutant where the target lysine residue is substituted (e.g., EPHB2 K892R) . For specificity controls, include structurally related but functionally distinct substrates to demonstrate selectivity. In cellular assays, include RNF186 knockout or knockdown cells alongside wildtype and rescue conditions. When analyzing ubiquitination patterns, use antibodies specific for different ubiquitin linkages (K48, K63, etc.) to characterize the type of ubiquitination. Finally, include proteasome inhibitors (MG132) or deubiquitinase inhibitors (PR-619) to stabilize ubiquitinated proteins when necessary for detection.

How can I design experiments to identify novel RNF186 substrates in bovine tissues?

Designing experiments to identify novel RNF186 substrates in bovine tissues requires a multi-faceted approach. Begin with computational prediction by analyzing protein interaction databases and performing in silico screening for proteins containing motifs similar to known RNF186 substrates like EPHB2 and RIP2 . For affinity purification mass spectrometry (AP-MS), express epitope-tagged bovine RNF186 in relevant bovine cell types (intestinal epithelial cells and macrophages), perform immunoprecipitation under non-denaturing conditions, and identify co-precipitating proteins by mass spectrometry. Compare results using wild-type RNF186, catalytically inactive mutants, and stimulated versus unstimulated conditions. Implement proximity-based labeling techniques (BioID or TurboID) by fusing RNF186 to a biotin ligase to label proteins in close proximity in living cells. Validate candidate substrates through reciprocal co-immunoprecipitation, in vitro ubiquitination assays, and ubiquitination site mapping via mass spectrometry. Functional validation should include examining how RNF186 knockdown affects the candidate substrate's stability, localization, or activity. Finally, confirm physiological relevance by investigating how dysregulation of these newly identified substrates contributes to phenotypes observed in RNF186-deficient models.

What techniques can effectively measure RNF186-dependent autophagy in bovine intestinal cells?

To effectively measure RNF186-dependent autophagy in bovine intestinal cells, researchers should employ multiple complementary techniques. Western blot analysis should quantify conversion of MAP1LC3B-I to MAP1LC3B-II and monitor SQSTM1 (p62) degradation, which have been established as reliable markers in RNF186 studies . Include controls with autophagy inducers (starvation, rapamycin) and inhibitors (chloroquine, bafilomycin A1) to distinguish between effects on autophagy induction versus flux . Implement fluorescence microscopy using cells transfected with GFP-MAP1LC3B to visualize and quantify autophagosome formation, with mRFP-GFP-MAP1LC3B tandem reporters allowing differentiation between autophagosomes and autolysosomes. For higher resolution analysis, transmission electron microscopy can directly visualize autophagic structures as demonstrated in RNF186 knockout studies . Functional assays should include monitoring clearance of long-lived proteins using pulse-chase methods and measuring bacterial clearance capacity using intracellular bacterial survival assays, which have proven sensitive to RNF186 function . For in vivo relevance, establish bovine intestinal organoids from wild-type and RNF186-deficient sources, and monitor their autophagy responses to relevant stimuli such as EFNB1 treatment .

Can recombinant bovine RNF186 be used to develop therapeutic strategies for inflammatory bowel diseases?

The therapeutic potential of recombinant bovine RNF186 for inflammatory bowel diseases derives from multiple lines of evidence suggesting RNF186's protective role in intestinal homeostasis. Studies demonstrate that RNF186 deficiency exacerbates DSS-induced colitis in mouse models, indicating its protective function . The mechanistic basis for this protection involves RNF186's dual roles: promoting autophagy in intestinal epithelial cells (enhancing bacterial clearance) and regulating PRR-induced signaling in macrophages (balancing inflammatory responses) . Of particular translational relevance, treatment with ephrin-B1-Fc recombinant protein effectively relieved DSS-induced colitis in mouse models by increasing autophagy in colonic epithelial cells, suggesting a potential therapeutic approach that acts through the RNF186-EPHB2 pathway . For developing bovine RNF186-based therapeutics, researchers should focus on: (1) comparing bovine and human RNF186 for functional equivalence, (2) engineering stabilized recombinant proteins that maintain E3 ligase activity, (3) developing targeted delivery systems for intestinal epithelial cells and resident macrophages, and (4) exploring combination approaches that address both autophagy deficiency and dysregulated inflammation. Additionally, screening for small molecules that enhance endogenous RNF186 expression or activity could provide alternative therapeutic strategies.

How do RNF186 functions in autophagy and innate immunity interact in intestinal homeostasis?

RNF186 functions in autophagy and innate immunity represent complementary mechanisms that together maintain intestinal homeostasis. In epithelial cells, RNF186 promotes EFNB1-EPHB2-induced autophagy, which enhances the clearance of intracellular bacteria - a critical function for maintaining the intestinal barrier . Concurrently, in macrophages, RNF186 regulates pattern recognition receptor (PRR) signaling by facilitating the assembly and ubiquitination of signaling complexes, which leads to appropriate cytokine production and antimicrobial responses . These dual functions allow RNF186 to coordinate both structural (epithelial) and immune cell responses to microbial challenges. The integration of these functions is evident in experimental models where RNF186 deficiency results in both impaired bacterial clearance and dysregulated inflammatory responses, leading to increased susceptibility to intestinal inflammation . Further supporting this integrated role, genetic variants that affect RNF186 function (A64T) or expression (rs6426833) compromise both autophagy and PRR-mediated outcomes . This suggests that RNF186 serves as a molecular link between epithelial cell homeostasis and innate immune regulation, with perturbations in either function potentially contributing to inflammatory bowel disease pathogenesis.

How should researchers interpret conflicting data on RNF186 expression across different studies?

When encountering conflicting data on RNF186 expression across different studies, researchers should systematically analyze several key variables. First, consider cell and tissue type specificity - RNF186 demonstrates notably different expression patterns and functions between colonic epithelial cells and macrophages, and even shows differential effects between colonic and kidney epithelial cells . Second, examine stimulus conditions, as RNF186 expression is dynamically regulated by factors such as NOD2 stimulation and bacterial exposure . Third, analyze the potential impact of genetic variants - carriers of the rs6426833 risk allele show lower baseline and stimulus-induced RNF186 expression . Fourth, evaluate methodological differences including antibody specificity, detection methods (flow cytometry vs. Western blot vs. qPCR), and timing of measurements . Fifth, consider species differences if comparing across model systems. When possible, perform parallel experiments using standardized conditions and multiple detection methods to validate expression patterns. Finally, focus on linking expression data with functional outcomes rather than expression levels alone, as the relationship between expression and function may not be linear, particularly when examining different splice variants or post-translational modifications.

What statistical approaches are most appropriate for analyzing RNF186-dependent cellular processes?

Analyzing RNF186-dependent cellular processes requires statistical approaches tailored to the specific experimental design and biological complexity. For gene expression studies comparing RNF186 levels across genotypes or conditions, ANOVA with appropriate post-hoc tests should be employed for multi-group comparisons, with consideration of normalization methods for qPCR data . When analyzing protein-protein interactions or ubiquitination events, quantitative co-immunoprecipitation or proximity ligation assay data should be analyzed using paired statistical tests to account for experimental variation . For autophagy measurements, which exhibit high cellular heterogeneity, mixed-effects models may better account for both fixed factors (genotype, treatment) and random factors (cell-to-cell variation) . Time-course experiments examining RNF186 expression or downstream signaling events should utilize repeated measures ANOVA or more sophisticated longitudinal data analysis methods . For bacterial clearance assays, survival analysis approaches might be more appropriate than simple endpoint comparisons . When examining pathway relationships, structural equation modeling can help determine whether RNF186 effects on outcomes (like inflammation) are mediated through specific mechanisms (like autophagy). Finally, meta-analytic approaches should be considered when synthesizing findings across multiple studies, particularly when reconciling conflicting results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.