Recombinant Bovine RPE-retinal G protein-coupled receptor (RGR)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bovine RGR

RGR belongs to the opsin family of G protein-coupled receptors (GPCRs) and is primarily expressed in retinal pigment epithelium (RPE) cells and Müller glia. It binds retinaldehyde chromophores and facilitates the photoisomerization of all-trans-retinal to 11-cis-retinal, a process essential for visual pigment regeneration under photopic (light-adapted) conditions . Recombinant RGR is produced via heterologous expression systems (e.g., baculovirus-infected insect cells) to study its biochemical properties and interactions .

Tissue Distribution

Tissue/Cell TypeExpression PatternSource
RPE CellsHigh expression in smooth endoplasmic reticulum
Müller GliaDetected in bovine and human, but low in mouse
Cone PhotoreceptorsPresent in outer segments, inner segments, and synaptic terminals
Retinal Ganglion CellsObserved in bovine and human retinas

Immunohistochemical Findings:

  • Cone Photoreceptors: RGR colocalizes with cone visual pigments (OPN1LW/MW, OPN1SW), suggesting functional interaction in chromophore regeneration .

  • RGR-d Isoform: Exon-6-skipped variant (RGR-d) localizes to cone outer segment tips, though expression varies among individuals .

RGR-Mediated Chromophore Regeneration

  1. Photoisomerization Pathway:

    • Substrate: All-trans-retinal (derived from retinol oxidation by RDH enzymes).

    • Product: 11-cis-retinal (accepted by CRALBP for protection).

    • Light Dependency: Activity peaks at 470–500 nm, matching its absorption spectrum .

  2. CRALBP Synergy:

    • CRALBP binds 11-cis-retinal with high specificity, preventing re-isomerization and enhancing RGR efficiency .

  3. In Vivo Relevance:

    • Cone Photoreceptor Sensitivity: RGR-deficient retinas lose light sensitivity faster under photopic conditions, with reduced recovery post-bleach .

    • RPE65 Complementarity: RGR compensates for RPE65 deficiency in mice, but double knockouts eliminate chromophore regeneration .

RGR-d (Exon-6-Skipped Isoform)

FeatureDescriptionSource
StructureTruncated protein lacking exon 6 (affecting transmembrane domain organization).
LocalizationPrimarily in cone outer segments (variable expression across individuals).
FunctionNonfunctional or disruptive; linked to retinal dysfunction in some cases.

Applications

  • Therapeutic Targeting: Studying RGR for retinitis pigmentosa treatments (mutations in RGR are linked to RP44) .

  • Mechanistic Studies: Recombinant RGR enables in vitro assays to dissect photoisomerization kinetics and CRALBP interactions .

Challenges

  • Species Variability: Low RGR expression in mouse Müller glia complicates cross-species translational research .

  • RGR-d Variability: Inconsistent expression of the exon-6-skipped isoform in humans complicates functional analysis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
RGR; RPE-retinal G protein-coupled receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
RGR
Target Protein Sequence
MAESGTLPTGFGELEVLAVGTVLLVEALSGLSLNILTILSFCKTPELRTPSHLLVLSLAL ADSGISLNALVAATSSLLRRWPYGSEGCQAHGFQGFVTALASICSSAAVAWGRYHHFCTR SRLDWNTAVSLVFFVWLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSRGDRNFTSFLFTM AFFNFLLPLFITVVSYRLMEQKLGKTSRPPVNTVLPARTLLLGWGPYALLYLYATIADAT SISPKLQMVPALIAKAVPTVNAMNYALGSEMVHRGIWQCLSPQRREHSREQ
Uniprot No.

Target Background

Function
This receptor binds all-trans- and 11-cis-retinal, exhibiting a preference for the former. It may catalyze the isomerization of the chromophore through a retinochrome-like mechanism.
Gene References Into Functions
  1. Research suggests that the cone photoreceptors of humans and cattle express a nonvisual opsin belonging to the Go/RGR or tetraopsin group. PMID: 30034210
Database Links

KEGG: bta:280911

STRING: 9913.ENSBTAP00000020822

UniGene: Bt.567

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Preferentially expressed at high levels in the retinal pigment epithelium (RPE) and Mueller cells of the neural retina.

Q&A

What is the Retinal G Protein-Coupled Receptor (RGR) and where is it localized?

RGR is a protein that structurally resembles visual pigments and other G protein-coupled receptors (GPCRs). It was first cloned from a retinal pigment epithelium (RPE)-enriched cDNA library and shares approximately 25% sequence identity with rhodopsin and 23% identity with squid photoisomerase. RGR is uniquely localized in specific intracellular compartments of RPE and Müller cells, distinguishing it from other visual system proteins. This distinctive localization pattern suggests specialized functions within these cellular contexts. The protein's structural similarity to GPCRs, particularly to visual pigments, indicates potential roles in light-dependent signaling pathways within the visual system.

What is the primary function of RGR in the vertebrate visual system?

RGR functions primarily as a retinal photoisomerase in the vertebrate visual system. Its essential role is to isomerize all-trans-retinal to 11-cis-retinal, which is critical for maintaining the photosensitivity of visual rhodopsins. This isomerization process is a key step in the visual cycle that allows for continuous visual function. Without this conversion, the supply of 11-cis-retinal would be depleted, compromising the regeneration of rhodopsin and other visual pigments after light exposure. The photoisomerase activity of RGR thus serves as a complementary mechanism to ensure the sustainability of visual perception under various lighting conditions.

How does bovine RGR compare to RGR from other species?

Spectroscopic and biochemical analyses have revealed that human and chicken RGRs form blue-absorbing pigments similar to bovine RGR, suggesting conservation of spectral properties across different vertebrate species. More significantly, both bovine and chicken RGRs have been characterized as bistable rhodopsins that display reversible photoreactions. This bistable nature allows these proteins to switch between two stable conformations upon light exposure, a property that is fundamental to their function as photoisomerases. The conservation of these properties across species indicates the evolutionary importance of RGR's function in vertebrate visual systems.

What is the mechanism of RGR's photoisomerase activity?

RGR functions as a bistable photopigment, capable of reversible photoreactions between its different retinal-bound states. When bound to all-trans-retinal, RGR absorbs light energy that induces isomerization to the 11-cis configuration. This photochemical reaction occurs within the protein's binding pocket, where specific amino acid residues facilitate the conformational change of the retinal chromophore. The bistable nature of RGR allows it to cycle between these states in response to different wavelengths of light, making it an efficient catalyst for retinoid isomerization. This mechanism differs from the unidirectional isomerization observed in visual rhodopsins and represents a specialized adaptation for maintaining chromophore supply in the visual cycle.

What are the phenotypic consequences of RGR deficiency in animal models?

Studies using rgr−/− knockout mice have revealed several distinctive phenotypic consequences. The most striking feature is the light-dependent formation of 9-cis- and 13-cis-retinoid isomers, which are not formed in wild-type mice. This aberrant isomerization occurs because all-trans-retinal, normally bound to RGR in wild-type mice, is unprotected from isomerization to these alternative cis forms in the knockout animals. Additionally, rgr−/− mice exhibit elevated levels of all-trans-retinyl esters (103 ± 29 pmol/eye compared to wild-type 28.5 ± 13 pmol/eye) and 13-cis-retinyl esters (30 ± 13 pmol/eye compared to almost undetectable levels in wild-type). Despite these biochemical alterations, the amount of rhodopsin and formation of rod outer segments remains unaffected, suggesting compensatory mechanisms that maintain basic visual function.

What are the optimal methods for expressing and purifying recombinant bovine RGR?

For successful expression and purification of recombinant bovine RGR, a mammalian expression system typically yields the most functionally relevant protein. The methodology involves:

  • Gene optimization: Synthesize the bovine RGR gene with codon optimization for mammalian expression.

  • Vector construction: Clone the optimized gene into a mammalian expression vector with an N-terminal tag (His or FLAG) for purification.

  • Cell culture: Transfect HEK293 or COS-7 cells and culture in the presence of 11-cis-retinal or all-trans-retinal to ensure proper chromophore incorporation.

  • Membrane preparation: Harvest cells and prepare membranes through differential centrifugation.

  • Solubilization: Extract RGR using mild detergents like n-dodecyl-β-D-maltoside (DDM) that preserve protein structure and function.

  • Affinity purification: Purify the tagged protein using appropriate affinity chromatography followed by size exclusion chromatography.

This approach yields functionally active RGR that can be used for spectroscopic and biochemical analyses to investigate its photochemical properties and interactions with other components of the retinoid cycle.

What spectroscopic techniques are most effective for characterizing RGR's photochemical properties?

The characterization of RGR's photochemical properties is best accomplished through a combination of complementary spectroscopic techniques:

  • UV-Visible absorption spectroscopy: Monitors the blue-absorbing spectrum characteristic of RGR (typically around 469-470 nm for bovine RGR) and tracks spectral shifts during photoisomerization.

  • Circular dichroism: Evaluates changes in protein secondary structure upon light activation.

  • Fluorescence spectroscopy: Measures the emission properties of the retinal chromophore within the RGR binding pocket.

  • Time-resolved spectroscopy: Captures the kinetics of photoisomerization reactions, essential for understanding the temporal dynamics of RGR function.

  • Resonance Raman spectroscopy: Provides detailed information about the configuration of the retinal chromophore and its protein environment.

These techniques, applied to both dark-adapted and light-exposed RGR samples, reveal the bistable nature of the protein and characterize its reversible photoreaction between different retinal-bound states. Such spectroscopic data is crucial for understanding how structural changes in RGR relate to its function as a retinal photoisomerase.

How can knockout mouse models be designed to study RGR function in vivo?

Designing knockout mouse models for studying RGR function requires a systematic approach:

  • Gene targeting strategy: Design targeting vectors to disrupt the rgr gene, typically by replacing exons encoding critical functional domains with a selection marker.

  • ES cell manipulation: Transfect embryonic stem cells with the targeting construct and select for homologous recombination events.

  • Chimeric mouse generation: Inject successfully targeted ES cells into blastocysts and implant into pseudopregnant females.

  • Breeding strategy: Establish heterozygous lines and cross to obtain homozygous knockout animals.

  • Validation: Confirm gene disruption through genomic PCR, RT-PCR, and Western blotting.

For comprehensive functional analysis, consider generating both single knockouts (rgr−/−) and double knockouts (e.g., rdh5−/−rgr−/− mice) to assess potential functional interactions between RGR and other retinoid cycle components. These models enable in-depth physiological studies including electroretinogram (ERG) recordings, retinoid profile analysis, and histological examination to evaluate the consequences of RGR deficiency on visual function and retinal homeostasis.

What analytical techniques are most appropriate for quantifying retinoid profiles in RGR studies?

For comprehensive retinoid profiling in RGR research, high-performance liquid chromatography (HPLC) coupled with various detection methods offers the most reliable approach:

  • Sample preparation: Extract retinoids from ocular tissues using organic solvents under dim red light to prevent photoisomerization.

  • Normal-phase HPLC: Separate retinoid isomers based on their polarity differences.

  • Reversed-phase HPLC: Provide complementary separation based on hydrophobicity.

  • Detection systems:

    • UV-Vis detection (360-380 nm) for routine quantification

    • Diode array detection for spectral identification of different isomers

    • Mass spectrometry for unambiguous identification and increased sensitivity

The following table outlines typical retinoid profiles observed in wild-type and rgr−/− mouse eyes:

Retinoid TypeWild-Type (pmol/eye)rgr−/− (pmol/eye)
11-cis-retinalComparable to WTComparable to WT
All-trans-retinyl esters28.5 ± 13103 ± 29
13-cis-retinyl estersAlmost undetectable30 ± 13
11-cis-retinyl estersLowElevated in rdh5−/−

This analytical approach permits detection of altered retinoid metabolism in knockout models, providing insights into RGR's role in retinoid isomerization and visual cycle homeostasis.

How can researchers evaluate RGR-mediated photoisomerization activity in vitro?

To evaluate RGR-mediated photoisomerization activity in vitro, researchers should employ a structured experimental approach:

  • Preparation of RGR-containing membranes or purified protein reconstituted in lipid vesicles.

  • Substrate preparation: Purify all-trans-retinal and verify its isomeric purity by HPLC.

  • Reaction conditions:

    • Dark control: Incubate RGR with all-trans-retinal in darkness

    • Light exposure: Illuminate matched samples with monochromatic light (typically blue light ~470 nm)

  • Time-course sampling: Extract aliquots at defined intervals during illumination.

  • Isomer analysis: Employ HPLC to quantify the conversion of all-trans-retinal to 11-cis-retinal.

  • Kinetic analysis: Calculate initial rates and determine reaction parameters.

This methodology can be extended to compare wild-type RGR with site-directed mutants, assess species differences, or evaluate the effects of various cofactors on photoisomerization efficiency. The inclusion of appropriate controls, such as opsin-free membranes or denatured protein preparations, is essential for distinguishing enzyme-catalyzed photoisomerization from spontaneous photochemical reactions.

How should researchers interpret contradictory data in RGR functional studies?

When confronted with contradictory data in RGR functional studies, researchers should implement a systematic approach to data reconciliation:

  • Methodological assessment: Compare experimental protocols in detail, as differences in tissue preparation, light conditions, or analytical methods can significantly impact results.

  • Genetic background effects: Consider whether contradictions arise from strain-specific differences in knockout models. Even subtle variations in genetic background can influence retinoid metabolism and visual function.

  • Age and light history: Account for the age of experimental animals and their prior light exposure, as these factors can alter baseline retinoid profiles and RGR expression levels.

  • Compensatory mechanisms: Evaluate potential upregulation of alternative isomerization pathways in RGR-deficient models that might mask phenotypes in some experimental conditions.

  • Statistical reevaluation: Reassess statistical analyses, particularly when comparing derived variables or ratios that may exhibit mathematical dependencies (similar to issues noted with relative growth rate analyses ).

  • Experimental validation: Design decisive experiments that specifically address the contradiction, incorporating multiple complementary techniques to provide convergent evidence.

When reporting results, researchers should explicitly acknowledge contradictions in the literature and provide reasoned interpretations that account for methodological differences or biological complexities that may underlie the discrepancies.

What are the emerging techniques for studying RGR interaction with other visual cycle proteins?

Emerging techniques for investigating RGR interactions with visual cycle proteins include:

  • Proximity labeling approaches: Technologies such as BioID or APEX2 can be fused to RGR to biotinylate nearby proteins in living cells, identifying transient or weak interactions with other visual cycle components.

  • Single-molecule FRET (Förster Resonance Energy Transfer): This technique can detect dynamic interactions between fluorescently labeled RGR and potential partner proteins, providing information about binding kinetics and conformational changes during the photocycle.

  • Cryo-electron microscopy: This rapidly advancing technology now enables structural determination of membrane protein complexes at near-atomic resolution, potentially revealing the molecular architecture of RGR in complex with RDH5 or other visual cycle proteins.

  • Crosslinking mass spectrometry (XL-MS): This approach can map interaction interfaces between RGR and binding partners by identifying crosslinked peptides, providing insights into the structural basis of functional complexes.

  • Optogenetic manipulation: Light-controlled activation or inhibition of RGR in specific cell types can reveal its temporal role in the visual cycle and identify downstream effectors.

These technologies promise to advance our understanding of RGR beyond isolated protein studies to comprehend its function within the complex network of visual cycle components.

How might computational approaches enhance our understanding of RGR function?

Computational approaches offer powerful tools for exploring RGR function at multiple levels:

  • Homology modeling and molecular dynamics simulations: Generate detailed structural models of RGR in different conformational states, predicting how retinal isomerization induces protein conformational changes.

  • Quantum mechanics/molecular mechanics (QM/MM) calculations: Investigate the electronic properties of the retinal chromophore within the RGR binding pocket to elucidate the mechanism of photoisomerization.

  • Systems biology modeling: Integrate RGR function into comprehensive models of the visual cycle to predict how perturbations affect retinoid homeostasis across different lighting conditions.

  • Network analysis: Map the protein-protein interaction network surrounding RGR to identify potential functional connections and regulatory pathways.

  • AI-assisted literature mining: Apply natural language processing tools to extract and synthesize information about RGR from the scientific literature, potentially revealing overlooked connections or contradictions that merit further investigation.

These computational approaches can generate testable hypotheses about RGR function that guide experimental design and help reconcile contradictory observations in the literature.

What potential clinical relevance might RGR research have for retinal degenerative diseases?

RGR research holds several potential clinical implications for retinal degenerative diseases:

  • Therapeutic target identification: Understanding RGR's role in maintaining retinoid homeostasis could reveal new intervention points for diseases characterized by aberrant retinoid metabolism, such as Stargardt disease or age-related macular degeneration.

  • Biomarker development: Changes in RGR expression or function might serve as early indicators of RPE dysfunction before clinical manifestations of retinal degeneration appear.

  • Gene therapy approaches: For conditions associated with RGR mutations or dysfunction, targeted gene replacement or supplementation strategies could restore normal retinoid cycling.

  • Pharmacological modulation: Small molecules that enhance RGR's photoisomerase activity could potentially accelerate visual cycle kinetics in conditions with delayed dark adaptation.

  • Cell replacement therapies: Understanding RGR's role in RPE function is crucial for developing effective RPE cell replacement approaches for treating degenerative conditions.

Future research should specifically investigate potential associations between RGR variants and susceptibility to retinal diseases, particularly those affecting the RPE or involving abnormal retinoid accumulation. Such studies may reveal previously unrecognized connections between RGR function and retinal pathophysiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.