Recombinant Bovine S-adenosylmethionine mitochondrial carrier protein (SLC25A26)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include your request in the order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A26; SAMC; S-adenosylmethionine mitochondrial carrier protein; Mitochondrial S-adenosylmethionine transporter; Solute carrier family 25 member 26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
SLC25A26
Target Protein Sequence
MDRPGFTASLVAGGVAGVSVDLILFPLDTIKTRLQSPQGFYKAGGFYGVYAGVPSTAIGS FPNAAAFFVTYEYVKWILHTDSSSYLMPVTHMLAASVGEVVACLIRVPSEVVKQRAQVSA SSGTFHIFSNILCQEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDRVVDSW QAAVCGAFAGGFAAAVTTPLDVAKTRIMLAKAGSSTASGNILSALHAVWRTQGLSGLFAG VFPRMAAISLGGFIFLGVYDQTRSFLLELGRESP
Uniprot No.

Target Background

Function
Mitochondrial solute carriers facilitate the transport of metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. Specifically, SLC25A26 mediates the transport of S-adenosylmethionine (SAM) into the mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of bovine SLC25A26 in mitochondria?

Bovine SLC25A26 encodes the mitochondrial S-adenosylmethionine carrier (SAMC) that transports SAM into mitochondria in exchange for SAH. Similar to its human counterpart, the primary physiological role of bovine SAMC is to exchange cytosolic SAM for mitochondrial SAH . SAM serves as the predominant methyl-group donor for mitochondrial methylation processes, including the methylation of mitochondrial DNA, RNA, and proteins .

These methylation processes are crucial for proper mitochondrial function, including RNA stability, tRNA maturation, and ribosomal assembly. Dysfunction of SLC25A26 can lead to impaired mitochondrial biosynthesis and deficiencies in respiratory chain complexes . The transport of SAM into mitochondria enables methylation reactions that are essential for maintaining mitochondrial protein synthesis and energy production.

What expression systems are suitable for producing recombinant bovine SLC25A26?

Several expression systems can be considered for the production of recombinant bovine SLC25A26, each with specific advantages:

Expression SystemAdvantagesLimitationsOptimization Strategies
Bacterial (E. coli)High yield, cost-effectivePotential inclusion bodiesUse specialized strains (C41/C43), fusion partners (MBP, SUMO)
Yeast (P. pastoris)Eukaryotic PTMs, suitable for membrane proteinsLonger expression timeMethanol-inducible promoters, genomic integration
Insect Cells (Sf9)Advanced PTMs, high expression for membrane proteinsHigher costOptimize MOI, enhance cell density cultivation
Mammalian Cells (CHO)Native-like PTMs, proper foldingHighest cost, lower yieldsStable cell line development, optimized media

When working with membrane proteins like SLC25A26, special consideration should be given to detergent selection for solubilization and purification. Mild detergents such as DDM, LMNG, or digitonin are typically effective for maintaining the functional integrity of mitochondrial carriers . The incorporation of affinity tags (His-tag, GST-tag) facilitates purification, while codon optimization can enhance expression in the chosen system.

What are the optimal conditions for functional characterization of recombinant bovine SLC25A26?

Functional characterization of recombinant bovine SLC25A26 requires careful attention to experimental conditions:

  • Buffer Composition:

    • pH: 7.0-7.5 to mimic physiological conditions

    • Salts: 100-150 mM NaCl or KCl

    • Stabilizers: 5-10% glycerol, 1-5 mM DTT

    • Detergents (for non-reconstituted protein): DDM (0.01-0.05%) or digitonin (0.1-0.5%)

  • Reconstitution Parameters:

    • Lipid composition: Mixture of PC, PE, and cardiolipin (4:1:1) to mimic mitochondrial inner membrane

    • Protein-to-lipid ratio: 1:50 to 1:100 (w/w)

    • Method: Detergent removal by dialysis or Bio-Beads

  • Assay Conditions:

    • Temperature: 25-30°C for transport assays

    • Substrate concentrations: 10 μM to 1 mM SAM/SAH

    • Countertransport conditions: Pre-loading with substrate followed by dilution

Based on studies of human SAMC, the bovine protein likely exhibits countertransport as its primary transport mechanism, exchanging cytosolic SAM for mitochondrial SAH . Unlike the yeast ortholog, human SAMC catalyzes virtually only countertransport and exhibits a higher transport affinity for SAM . Similar properties would be expected for bovine SLC25A26, though specific kinetic parameters would need to be experimentally determined.

How can transport activity of recombinant bovine SLC25A26 be measured?

Several complementary approaches can be used to measure the transport activity of recombinant bovine SLC25A26:

  • Radiolabeled Substrate Transport Assay:

    • Reconstitute purified SLC25A26 into liposomes

    • Incubate with radiolabeled substrates ([³H]-SAM or [³⁵S]-SAM)

    • Separate liposomes using rapid filtration or size exclusion chromatography

    • Quantify internalized radioactivity by liquid scintillation counting

  • Counterflow Assay:

    • Particularly relevant for SLC25A26, which functions primarily as a countertransporter

    • Preload liposomes with high concentration of unlabeled substrate

    • Dilute into medium containing low concentration of radiolabeled substrate

    • Monitor transient accumulation of radiolabeled substrate inside liposomes

  • Fluorescence-Based Methods:

    • Encapsulate fluorescent indicators within liposomes during reconstitution

    • Monitor changes in fluorescence upon substrate transport

    • Provides real-time monitoring without separation steps

Transport assays should include appropriate controls, such as protein-free liposomes and specific inhibitors like tannic acid and Bromocresol Purple, which strongly inhibit human SAMC and likely affect bovine SLC25A26 similarly. Kinetic parameters (Km, Vmax) can be determined by varying substrate concentrations and measuring initial transport rates.

How do mutations in bovine SLC25A26 affect its transport activity and what are the metabolic implications?

Mutations in SLC25A26 can significantly impact transport activity and downstream metabolic pathways. Based on studies of human SLC25A26 variants, we can predict the following effects for bovine SLC25A26 mutations:

Metabolic PathwayImpact of SLC25A26 DysfunctionDownstream Effects
Mitochondrial MethylationReduced mtDNA/RNA methylationImpaired RNA stability, tRNA maturation, and protein synthesis
Respiratory ChainDecreased expression of key subunitsReduced activity of complexes I, III, and IV; diminished ATP production
Coenzyme BiosynthesisImpaired LA and CoQ10 biosynthesisReduced activity of PDH and α-KGDH; compromised electron transport
Redox BalanceAltered methionine cycleChanges in homocysteine and glutathione levels; increased ROS

In human patients, pathogenic SLC25A26 variants cause a mitochondrial disease called combined oxidative phosphorylation deficiency 28 (COXPD28) . Severe early-onset cases are associated with mutations that impair SAM transport into mitochondria, while milder late-onset cases are linked to mutations affecting SAH transport out of mitochondria .

Pathogenic variants in SLC25A26 impair mitochondrial RNA stability, protein synthesis, and the biosynthesis of lipoic acid and CoQ10, ultimately affecting the TCA cycle and mitochondrial respiratory chain . These disruptions lead to mitochondrial dysfunction and energy production deficits.

What role does bovine SLC25A26 play in cancer metabolism?

Recent studies have revealed that SLC25A26 expression is aberrantly regulated in various cancers, suggesting it plays a significant role in cancer metabolism:

  • Expression in Different Cancers:

    • Downregulated in invasive cervical cancer, potentially associated with cancer invasiveness

    • Highly expressed in low-grade glioma with the rs11706832 alternative allele C

    • Low expression in liver cancer compared to adjacent tissues

    • Negatively correlated with 10-year survival in non-small cell lung cancer

    • Highly expressed in most colorectal cancer patients

  • Mechanisms in Cancer Progression:

In cervical cancer cells, SLC25A26 promoter hypermethylation results in downregulation of SLC25A26 expression, leading to:

  • Decreased mitochondrial SAM levels

  • Mitochondrial DNA hypomethylation

  • Enhanced expression of respiratory complex subunits

  • Increased mitochondrial ATP generation

  • Enhanced methionine cycle in cytoplasm

  • Reduced homocysteine and ROS

  • Increased glutathione for better antioxidant defense

These changes collectively promote cancer cell survival and proliferation. Conversely, overexpression of SLC25A26 has been shown to:

  • Increase mitochondrial SAM levels

  • Enhance mitochondrial DNA methylation

  • Inhibit respiratory complex expression

  • Reduce ATP generation

  • Enhance cytochrome C release (apoptosis trigger)

  • Disrupt the methionine cycle

  • Increase homocysteine and ROS levels

  • Reduce glutathione and antioxidant defenses

These effects can arrest the cell cycle in S phase and enhance chemosensitivity to drugs like cisplatin. The dual nature of SLC25A26's role in cancer suggests that both inhibitors and activators could potentially be developed as cancer therapeutics, depending on the specific cancer type and context.

How can isotope labeling be used to track SAM transport mediated by bovine SLC25A26?

Isotope labeling provides powerful tools for studying SLC25A26-mediated transport with high sensitivity and specificity:

  • Radiolabeled SAM Transport:

    • Use SAM labeled with radioisotopes ([³H]-SAM, [¹⁴C]-SAM, or [³⁵S]-SAM)

    • Measure uptake into SLC25A26-containing liposomes over time

    • Determine transport kinetics (Km, Vmax) and inhibition profiles

  • Stable Isotope Labeling for Mass Spectrometry:

    • Employ SAM with stable isotopes ([¹³C]-SAM, [¹⁵N]-SAM, [²H]-SAM)

    • Track transport and subsequent methylation reactions by LC-MS/MS

    • Monitor the fate of labeled methyl groups in downstream methylated products

  • Pulse-Chase Experiments:

    • Briefly expose systems to isotope-labeled SAM (pulse)

    • Replace with unlabeled substrates (chase)

    • Monitor transport dynamics and exchange rates between SAM and SAH

  • In Vivo Flux Analysis:

    • Administer isotope-labeled methionine to bovine cells

    • Trace its conversion to SAM and transport into mitochondria

    • Apply metabolic flux analysis to quantify pathway activities

These approaches can reveal critical insights about:

  • The bidirectional transport capabilities of SLC25A26

  • Substrate specificity and selectivity

  • Integration of mitochondrial methylation with cellular metabolism

  • Effects of potential inhibitors or genetic variants on transport function

Additionally, isotope labeling can help distinguish between direct transport and metabolism, providing a clearer picture of SLC25A26's specific role in the complex network of one-carbon metabolism.

What methods can be used to study the interaction of bovine SLC25A26 with other mitochondrial proteins?

Understanding protein-protein interactions involving bovine SLC25A26 requires specialized approaches suitable for membrane proteins:

  • Proximity Labeling:

    • Generate SLC25A26 fusions with BioID or APEX2 enzymes

    • Express in bovine cells or tissues

    • Activate enzyme to biotinylate proteins in close proximity

    • Identify labeled proteins by mass spectrometry

  • Crosslinking Mass Spectrometry:

    • Treat intact mitochondria with chemical crosslinkers

    • Digest proteins and analyze by specialized mass spectrometry

    • Identify crosslinked peptides to map interaction interfaces

    • Provides structural information about protein complexes

  • Co-immunoprecipitation with Mild Detergents:

    • Solubilize mitochondrial membranes with digitonin or DDM

    • Immunoprecipitate SLC25A26 using specific antibodies

    • Identify co-precipitated proteins by mass spectrometry

    • Verify interactions with targeted Western blotting

  • Förster Resonance Energy Transfer (FRET):

    • Create fluorescent protein fusions of SLC25A26 and potential partners

    • Express in cells and measure energy transfer between fluorophores

    • Positive FRET signal indicates proximity (<10 nm)

    • Enables real-time monitoring in living cells

Potential interaction partners for bovine SLC25A26 might include:

  • Other metabolite transporters forming transport complexes

  • Enzymes involved in mitochondrial methylation reactions

  • Components of protein import machinery

  • Regulatory proteins that modulate transport activity

Understanding these interactions could reveal how SLC25A26 is integrated into broader metabolic networks and regulatory systems within mitochondria.

How does post-translational modification affect bovine SLC25A26 function?

Post-translational modifications (PTMs) likely play important roles in regulating bovine SLC25A26 function:

  • Phosphorylation:

    • Potential sites: Serine/threonine residues in matrix-exposed loops

    • Likely kinases: PKA, PKC, AMPK, mitochondrial kinases

    • Functional effects: Altered substrate affinity, transport velocity, protein interactions

    • Detection methods: Phosphoproteomic mass spectrometry, phospho-specific antibodies

  • Acetylation:

    • Potential sites: Lysine residues not involved in substrate binding

    • Regulatory enzymes: Mitochondrial acetyltransferases, sirtuins

    • Functional effects: Altered electrostatic properties, protein stability

    • Detection methods: Acetylome analysis, site-directed mutagenesis

  • Oxidative Modifications:

    • Potential sites: Cysteine and methionine residues

    • Conditions promoting modification: Oxidative stress, altered redox balance

    • Functional effects: Potentially decreased transport activity

    • Relevance: May link SLC25A26 function to cellular redox state

To study PTMs of bovine SLC25A26:

  • Use mass spectrometry-based PTM mapping

  • Generate site-directed mutants (non-modifiable or modification-mimicking)

  • Assess transport activity under conditions affecting PTM status

  • Compare PTM patterns across different physiological and pathological states

Understanding the PTM landscape could provide opportunities to modulate SLC25A26 activity through targeting the enzymes responsible for these modifications.

What role does SLC25A26 play in mitochondrial disease pathogenesis?

SLC25A26 dysfunction is directly linked to a specific mitochondrial disease:

  • Combined Oxidative Phosphorylation Deficiency 28 (COXPD28):

    • Caused by biallelic pathogenic variants in SLC25A26

    • Severity ranges from mild symptoms to fatal multiorgan failure

    • Common features: Muscle weakness, hyperlactatemia, respiratory chain deficiencies

  • Disease Mechanisms:

    • Severe early-onset phenotype: Associated with impaired SAM transport into mitochondria

    • Milder late-onset phenotype: Linked to defective SAH transport out of mitochondria

    • Consequences include:

      • Impaired mitochondrial RNA stability and tRNA maturation

      • Defective ribosomal assembly and protein synthesis

      • Hypomethylation of mitochondrial components

      • Reduced levels of lipoic acid-dependent enzyme complexes

      • Impaired CoQ10 biosynthesis

      • Significant decrease in mitochondrial ATP production

  • Cellular Pathology:

    • Decreased activity of respiratory chain complexes I, III, and IV

    • Reduced function of pyruvate dehydrogenase complex (PDHC)

    • Impaired α-ketoglutarate dehydrogenase (α-KGDH) activity

    • Compromised electron transport and oxidative phosphorylation

These findings underscore the essential role of SLC25A26 in mitochondrial function and highlight potential therapeutic approaches targeting methylation metabolism for mitochondrial diseases.

What potential therapeutic strategies could target bovine SLC25A26?

Based on current understanding of SLC25A26 function and its role in disease, several therapeutic strategies could be considered:

  • For Mitochondrial Diseases (COXPD28):

    • SAM supplementation: May bypass transport defects in specific variants

    • Targeted methylation support: Provide alternative methyl donors

    • Mitochondrial enhancers: CoQ10, lipoic acid supplementation to address downstream deficiencies

    • Gene therapy: Delivery of functional SLC25A26 to affected tissues

  • For Cancer Applications:

    • Context-dependent approaches based on cancer type:

      • SLC25A26 inhibitors: For cancers where high expression promotes growth

      • SLC25A26 activators: For cancers exploiting low SLC25A26 expression

    • Combined approaches: SLC25A26 modulation with chemotherapy (e.g., cisplatin)

    • Metabolic interventions: Methionine restriction coupled with SLC25A26 upregulation

  • Known Modulators:

    • Inhibitors: Tannic acid, Bromocresol Purple (known to inhibit human SAMC)

    • Activators: Novel copper complex CTB (shown to upregulate SLC25A26 expression)

  • Potential Screening Approaches:

    • High-throughput transport assays using reconstituted protein

    • Cell-based reporter systems for SLC25A26 expression

    • Phenotypic screens in disease models

The novel copper complex CTB has demonstrated anti-hepatocellular carcinoma effects by upregulating SLC25A26 expression in mice , while SLC25A26 knockout in colorectal cancer cells led to tumor regression . These findings highlight the therapeutic potential of targeting this transporter in specific cancer contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.