Recombinant Bovine Secretory carrier-associated membrane protein 4 (SCAMP4)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Bovine SCAMP4 is a full-length, 230-amino acid protein (UniProt ID: Q58DF6) fused with an N-terminal His tag for purification and detection . Key specifications include:

PropertyDetails
Molecular Weight~26.9 kDa
Expression SystemEscherichia coli (E. coli)
Purity>90% (verified by SDS-PAGE)
Storage Conditions-20°C/-80°C in Tris/PBS buffer with 5%–50% glycerol
Functional DomainFour transmembrane regions (TMRs), lacking NPF repeats

This recombinant form retains native structural features critical for membrane interaction and vesicle trafficking .

Functional Role in Cellular Senescence

SCAMP4 is a key regulator of SASP, enhancing the secretion of pro-inflammatory cytokines and chemokines in senescent cells :

  • Mechanism: Silencing SCAMP4 reduces interleukin 6 (IL-6), IL-8, GDF-15, and CXCL1 secretion by 40%–60%, while overexpression increases their release .

  • Senescence Link: SCAMP4 stabilizes on senescent cell surfaces, bypassing ubiquitin-proteasome degradation seen in proliferating cells. This promotes autocrine signaling that amplifies local senescence .

Key Findings from Senescence Studies:

  • SCAMP4 overexpression in fibroblasts upregulated p16 and SASP-related mRNAs within 3 days .

  • SCAMP4-deficient senescent cells showed impaired IL-6 and IL-8 secretion, confirming its role in SASP amplification .

SASP and Aging Studies

Recombinant SCAMP4 is used to:

  • Model senescence in bovine fibroblasts or human cell lines .

  • Screen inhibitors targeting SASP-driven inflammation in age-related diseases .

Membrane Trafficking Assays

  • Investigates cargo sorting in secretory pathways via in vitro reconstitution .

  • Validates SCAMP4 antibodies (e.g., MyBioSource MBS576761) for immunoblotting and imaging .

Comparative Biology

  • Cross-species studies leverage bovine SCAMP4’s homology with mouse (82% sequence identity) and human variants .

Production and Quality Control

The recombinant protein is optimized for consistency:

  • Expression: Induced in E. coli BL21 strains under IPTG-regulated promoters .

  • Purification: Immobilized metal affinity chromatography (IMAC) via His tag .

  • Validation: Confirmed by Western blot, mass spectrometry, and functional assays (e.g., cytokine ELISAs) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing that tag.
Synonyms
SCAMP4; Secretory carrier-associated membrane protein 4; Secretory carrier membrane protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SCAMP4
Target Protein Sequence
MSGKENNFPPLPKFIPLKPCFYQNFSDEIPIEHQVLVKRIYRLWLFYCATLGVNLVACLA WWIAGGSGANFGLALLWLLLFSPCGYVCWFRPAYKAFRSDSSFNFMAFFFIFGAQFILTI IQAVGFSGWGACGWLAAIGFFQTSVGAAVVMLLPAIMFSMSAAMMAVMIMKVHSIYRGTG GSFQKAQTEWSTGTWRNPPSREAQFNNFSGNSLPEYPTVPSYPASGGQWP
Uniprot No.

Target Background

Function
Likely involved in membrane protein trafficking.
Database Links
Protein Families
SCAMP family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is SCAMP4 expression regulated in bovine tissues?

SCAMP4 expression regulation operates through post-translational mechanisms rather than transcriptional control. Research indicates that while mRNA levels remain relatively stable across different cellular states, protein levels are primarily regulated through protein stability mechanisms. Specifically, in proliferating cells, SCAMP4 undergoes rapid degradation via the ubiquitin-proteasome system (UPS) with a half-life of approximately 1.5 hours, while in senescent cells the protein becomes markedly stabilized . This differential stability allows for dynamic regulation of SCAMP4 levels in response to cellular conditions without requiring changes in gene expression. Bovine tissues likely employ similar post-translational regulation, though specific tissue-dependent variations may exist that warrant further investigation.

What are the optimal conditions for expressing recombinant bovine SCAMP4 in mammalian expression systems?

For optimal expression of recombinant bovine SCAMP4 in mammalian expression systems, researchers should consider the following methodology:

  • Expression Vector Selection: Use vectors containing strong promoters such as CMV for constitutive expression or inducible systems (e.g., tetracycline-regulated) for controlled expression.

  • Cell Line Optimization: HEK293T cells typically yield high expression levels for membrane proteins. For more physiologically relevant studies, consider bovine cell lines such as Madin-Darby Bovine Kidney (MDBK) cells.

  • Transfection Protocol:

    • For transient expression: Lipid-based transfection reagents achieve 70-80% efficiency in HEK293T cells

    • For stable expression: Select transfected cells using appropriate antibiotic resistance markers and validate expression

  • Expression Conditions:

    • Culture temperature: 37°C for standard expression; reduce to 30-32°C post-transfection to improve folding

    • Harvest timing: 48-72 hours post-transfection for optimal protein levels

    • Consider proteasome inhibitors (e.g., MG132 at 5-10 μM for 4-6 hours) to increase protein yield, as SCAMP4 is subject to rapid proteasomal degradation in proliferating cells

  • Protein Tagging Strategy: C-terminal tags (FLAG, His, or GFP) are preferable to N-terminal tags to avoid interfering with membrane insertion and trafficking signals.

What purification strategies yield the highest purity and activity for recombinant bovine SCAMP4?

Purification of recombinant bovine SCAMP4 requires specialized approaches due to its integral membrane protein characteristics:

  • Membrane Fraction Isolation:

    • Harvest cells and disrupt by sonication or nitrogen cavitation

    • Perform differential centrifugation (10,000g for 10 min to remove debris, followed by 100,000g for 1 hour to collect membrane fraction)

    • Resuspend membrane pellet in buffer containing 25 mM HEPES pH 7.4, 150 mM NaCl with protease inhibitors

  • Solubilization Strategy:

    • Test multiple detergents: n-dodecyl-β-D-maltoside (DDM, 1-1.5%), digitonin (1%), or CHAPS (0.5-1%)

    • Incubate at 4°C for 1-2 hours with gentle rotation

    • Remove insoluble material by centrifugation at 100,000g for 30 minutes

  • Affinity Chromatography:

    • For His-tagged SCAMP4: Ni-NTA resin with imidazole gradient elution (20-250 mM)

    • For FLAG-tagged SCAMP4: Anti-FLAG M2 affinity gel with competitive elution using FLAG peptide

    • Incorporate 0.1% detergent in all buffers to maintain protein solubility

  • Size Exclusion Chromatography:

    • Further purify using Superdex 200 column to remove aggregates and isolate monodisperse protein

    • Buffer composition: 20 mM HEPES pH 7.4, 150 mM NaCl, 0.05% DDM or appropriate detergent

  • Quality Control Assessment:

    • Verify purity by SDS-PAGE (>90% single band)

    • Confirm identity by Western blot using anti-SCAMP4 antibodies

    • Assess oligomeric state by native PAGE or analytical ultracentrifugation

What antibody-based detection methods are most reliable for bovine SCAMP4 identification?

For reliable detection of bovine SCAMP4 in experimental settings, researchers should consider these methodological approaches:

  • Western Blot Analysis:

    • Sample preparation: Include proteasome inhibitors during lysis to prevent degradation

    • Protein separation: 10-12% SDS-PAGE gels optimize resolution of SCAMP4 (~25 kDa)

    • Transfer conditions: Semi-dry transfer at 15V for 30 minutes or wet transfer at 30V overnight at 4°C for membrane proteins

    • Primary antibodies: Polyclonal anti-SCAMP4 antibodies generated against conserved regions show cross-reactivity with bovine SCAMP4

    • Detection sensitivity: Enhanced chemiluminescence detection with exposure times of 1-5 minutes typically yields optimal results

  • Immunofluorescence Microscopy:

    • Fixation: 4% paraformaldehyde for 15 minutes preserves membrane structures

    • Permeabilization: 0.1% Triton X-100 for cytoplasmic epitopes or 0.1% saponin for selective membrane permeabilization

    • Blocking: 5% BSA or 10% serum from the secondary antibody host species

    • Antibody dilution: Typically 1:100-1:500 for primary antibodies against SCAMP4

    • Co-localization markers: Include antibodies against known compartment markers (e.g., Golgi, endosomes) to establish subcellular localization

  • Immunohistochemistry for Tissue Sections:

    • Antigen retrieval: Citrate buffer (pH 6.0) heat-induced epitope retrieval improves detection

    • Detection systems: ABC (avidin-biotin complex) or polymer-based detection systems enhance sensitivity

    • Controls: Include isotype controls and pre-absorption controls to validate specificity

  • Flow Cytometry:

    • Surface detection: Non-permeabilized cells for membrane-exposed epitopes

    • Intracellular detection: Fixation with 2% paraformaldehyde followed by permeabilization with 0.1% saponin

    • Antibody validation: Confirm specificity using SCAMP4 knockdown or knockout samples

How does SCAMP4 contribute to cellular secretory pathways in bovine cells?

SCAMP4 plays a crucial role in regulating secretory pathways in bovine cells, functioning as a mediator of vesicular transport and membrane trafficking. Based on research findings across mammalian systems, SCAMP4 likely facilitates the following secretory processes in bovine cells:

  • Vesicle Trafficking Regulation: SCAMP4 associates with transport vesicles, potentially functioning in the sorting and trafficking of cargo proteins between the Golgi apparatus and plasma membrane, despite lacking the NPF repeats found in other SCAMP family members .

  • Secretory Vesicle Fusion: Evidence suggests SCAMP4 may participate in the docking and fusion of secretory vesicles with the plasma membrane, particularly during stimulated secretion events in specialized cell types.

  • Secretome Enhancement: Research demonstrates that SCAMP4 significantly enhances secretory output, particularly in senescent cells. In human fibroblast models, SCAMP4 promotes the secretion of senescence-associated secretory phenotype (SASP) factors including interleukins, chemokines, and growth factors . Similar mechanisms likely operate in bovine cellular systems.

  • Secretory Pathway Stabilization: SCAMP4 appears to stabilize components of the secretory machinery, potentially through interactions with SNARE proteins or other membrane fusion components, though the exact molecular mechanisms remain under investigation.

  • Tissue-Specific Secretion Regulation: In secretory bovine tissues (e.g., mammary gland), SCAMP4 may regulate specialized secretory functions, though tissue-specific studies remain limited.

What potential roles does SCAMP4 play in bovine cellular senescence pathways?

SCAMP4 demonstrates significant involvement in cellular senescence pathways, with implications for bovine cellular aging processes:

How do SCAMP4 expression patterns compare between proliferating and senescent bovine cells?

The expression patterns of SCAMP4 differ markedly between proliferating and senescent bovine cells, primarily through post-translational regulation mechanisms:

Comparative Expression Profile:

ParameterProliferating CellsSenescent CellsAnalytical Method
mRNA ExpressionBaseline levelsNo significant changeRT-qPCR
Protein AbundanceLowHigh (5-8 fold increase)Western blot
Protein Half-life~1.5 hoursHighly stable (>24 hours)Cycloheximide chase
UbiquitinationHighLowImmunoprecipitation
Subcellular LocalizationPrimarily intracellularEnriched at plasma membraneImmunofluorescence
Response to MG132 (proteasome inhibitor)Rapid accumulationMinimal effectWestern blot

Research demonstrates that SCAMP4 protein levels are regulated primarily through differential protein stability rather than transcriptional control. In proliferating cells, SCAMP4 is rapidly degraded through the ubiquitin-proteasome system, with experimental evidence showing ubiquitination at specific lysine residues (particularly K4 and K185) . Conversely, in senescent cells, this degradation pathway is suppressed, allowing SCAMP4 protein to accumulate to high levels despite no significant increase in mRNA expression.

Treatment with the proteasome inhibitor MG132 causes SCAMP4 accumulation within 4 hours in proliferating cells but has minimal effect in senescent cells, further confirming the proteasome-dependent regulation mechanism . This post-translational regulatory pattern appears conserved across mammalian species and likely applies to bovine cellular systems, though bovine-specific studies would be valuable to confirm these regulatory mechanisms.

What are the potential interactions between SCAMP4 and calcium channel regulation in bovine cells?

Recent research on SCAMP family proteins suggests potential interactions between SCAMP4 and calcium channel regulation in bovine cells, though direct studies on SCAMP4-calcium channel interactions remain limited. SCAMP5, a related family member, has been shown to regulate T-type calcium channels by reducing their expression in the plasma membrane . This raises important questions about whether SCAMP4 might have similar or complementary functions:

  • Potential Regulatory Mechanisms: Given that SCAMP5 nearly abolishes whole-cell T-type currents when co-expressed with Cav3.1, Cav3.2, and Cav3.3 channels, SCAMP4 may exhibit parallel regulatory effects on calcium channel trafficking or stability in the plasma membrane .

  • Comparative Analysis Framework: Future research should examine whether SCAMP4, like SCAMP5, affects intramembrane charge movements associated with calcium channels, which would indicate alterations in the functional expression of channels in the plasma membrane rather than changes in channel gating properties.

  • Physiological Implications: In bovine excitable cells (neurons, cardiac cells), SCAMP4-mediated regulation of calcium channels could significantly impact cellular excitability, calcium signaling, and downstream physiological processes.

  • Experimental Approaches: Electrophysiological studies combining patch-clamp recordings with SCAMP4 manipulation (overexpression, knockdown) in bovine cells expressing calcium channels would help elucidate these potential interactions.

  • Structure-Function Analysis: Chimeric protein approaches between SCAMP4 and SCAMP5 could identify critical domains responsible for calcium channel regulation and determine whether these functions are shared or distinct between family members.

How can CRISPR-Cas9 technology be optimized for studying SCAMP4 function in bovine cell models?

Optimizing CRISPR-Cas9 approaches for studying SCAMP4 in bovine cell models requires specialized strategies:

  • Guide RNA Design for Bovine SCAMP4:

    • Target highly conserved exonic regions to ensure efficient gene disruption

    • Design multiple sgRNAs (3-4) targeting different exons to increase knockout efficiency

    • Verify target specificity against the bovine genome (Bos taurus UMD3.1/bosTau8) to minimize off-target effects

    • For precise editing, consider sgRNAs with predicted high on-target and low off-target scores based on algorithms like Doench 2016 or CFD

  • Delivery Methods for Bovine Cells:

    • Nucleofection (Amaxa system): Typically achieves 30-50% transfection efficiency in bovine fibroblasts

    • Lentiviral transduction: For difficult-to-transfect primary bovine cells, achieving >80% transduction efficiency

    • Lipid-based transfection: Optimal for established bovine cell lines (e.g., MDBK)

  • Validation Strategies:

    • Genomic verification: T7E1 assay or Sanger sequencing to confirm edits

    • Protein-level validation: Western blot using validated anti-SCAMP4 antibodies

    • Functional validation: Assess secretory capacity using reporter systems (e.g., Gaussia luciferase secretion assay)

  • Experimental Design Considerations:

    • Generate multiple independent knockout clones to control for clonal variation

    • Include rescue experiments with wildtype SCAMP4 to confirm phenotype specificity

    • For temporal control, consider inducible CRISPR systems (Tet-regulated Cas9)

  • Advanced CRISPR Applications:

    • For studying protein interactions: Consider CRISPR-mediated endogenous tagging with FLAG or HA tags

    • For studying specific domains: Use CRISPR-mediated homology-directed repair to introduce point mutations

    • For regulatory studies: Apply CRISPRi or CRISPRa to modulate SCAMP4 expression without permanent genomic alterations

What methodological approaches are most effective for studying SCAMP4's role in bovine cellular trafficking and secretion?

Investigating SCAMP4's function in bovine cellular trafficking and secretion requires multiple complementary methodological approaches:

  • Live-Cell Imaging Techniques:

    • Fluorescent protein fusion: Create SCAMP4-GFP/mCherry fusions for real-time trafficking visualization

    • Vesicle tracking: Combine with markers for different compartments (Rab5-early endosomes, Rab7-late endosomes, Rab11-recycling endosomes)

    • TIRF microscopy: To visualize membrane-proximal events during vesicle fusion

    • Photoactivatable or photoconvertible tags: For pulse-chase analysis of SCAMP4 trafficking

    • Practical parameters: Image acquisition at 1-5 frames/second for fast trafficking events; maintain cells at 37°C during imaging

  • Secretion Assay Systems:

    • Reporter protein secretion: Measure secretion of co-expressed Gaussia luciferase or alkaline phosphatase

    • Endogenous protein secretion: Quantify secreted factors by ELISA or multiplex cytokine arrays

    • Metabolic labeling: Use 35S-methionine pulse-chase to track newly synthesized secretory proteins

    • Calcium-stimulated secretion: Measure regulated secretion in response to calcium ionophores (ionomycin)

  • Protein-Protein Interaction Studies:

    • Proximity labeling: BioID or APEX2 fused to SCAMP4 to identify proximal interactors in living cells

    • Co-immunoprecipitation: Use epitope-tagged SCAMP4 to pull down interaction partners

    • FRET/BRET analysis: To study dynamic interactions with trafficking machinery components

    • Yeast two-hybrid screening: To identify novel interactors from bovine cDNA libraries

  • Functional Perturbation Strategies:

    • Dominant-negative approaches: Express trafficking-defective SCAMP4 mutants

    • siRNA knockdown: Assess acute effects of SCAMP4 depletion on secretory pathways

    • CRISPR knockout: For complete elimination of SCAMP4 expression

    • Drug perturbations: Combine with Brefeldin A or Golgicide A to disrupt specific secretory compartments

  • Quantitative Analysis Framework:

    • High-content imaging: Automated analysis of trafficking parameters across large cell populations

    • Flow cytometry: For surface protein expression and internalization kinetics

    • Proteomics: TMT or SILAC labeling to quantify secretome changes upon SCAMP4 manipulation

    • Computational modeling: Track vesicle movement parameters (velocity, directionality, fusion events)

How conserved is SCAMP4 structure and function across mammalian species?

SCAMP4 demonstrates notable evolutionary conservation across mammalian species, reflecting its fundamental importance in cellular trafficking processes:

  • Sequence Conservation Analysis:
    The SCAMP4 protein shows high sequence conservation across mammals, with bovine SCAMP4 sharing approximately 90-95% amino acid identity with human SCAMP4 and 85-90% with rodent orthologs . This high degree of conservation is particularly evident in the transmembrane domains and C-terminal cytoplasmic regions, suggesting functional constraints on these structural elements.

  • Structural Domain Conservation:
    All mammalian SCAMP4 proteins share the characteristic arrangement of four transmembrane domains and lack the N-terminal NPF repeats found in other SCAMP family members (SCAMP1-3) . This consistent structural organization across species indicates evolutionary pressure to maintain SCAMP4's distinct functional properties.

  • Expression Pattern Conservation:
    SCAMP4 expression profiles appear similar across mammalian species, with widespread distribution in diverse tissues including brain, heart, kidney, and liver. The protein has been identified in human, mouse, rat, cow, cat, dog, sheep, and other mammalian species , suggesting conserved regulatory mechanisms and functional importance.

  • Functional Conservation:
    Studies across different mammalian models indicate consistent involvement of SCAMP4 in membrane trafficking and secretory processes. The protein's role in enhancing secretory capacity, particularly in senescent cells, appears to be a conserved function across mammalian systems .

  • Evolutionary Divergence Points:
    Despite high conservation, species-specific variations exist in non-critical regions, potentially reflecting adaptations to tissue-specific functions or interactions with divergent partner proteins. These variations may fine-tune SCAMP4 function in species-specific contexts while maintaining core functionality.

What are the methodological challenges in distinguishing SCAMP4 functions from other SCAMP family members?

Investigating SCAMP4's unique functions presents several methodological challenges that researchers must address:

  • Antibody Cross-Reactivity Issues:

    • Challenge: Commercial antibodies may cross-react with other SCAMP family members due to sequence similarities in conserved domains

    • Solution: Validate antibody specificity using SCAMP4 knockout controls and peptide competition assays

    • Recommended approach: Use epitopes from unique regions of SCAMP4 for antibody generation and validation

  • Functional Redundancy Assessment:

    • Challenge: Other SCAMP proteins may compensate for SCAMP4 loss in knockout models, masking phenotypes

    • Solution: Implement combinatorial knockdown/knockout approaches targeting multiple SCAMP family members

    • Analytical strategy: Quantify compensatory upregulation of other SCAMPs following SCAMP4 depletion

  • Domain-Specific Function Analysis:

    • Challenge: Determining which functions are specific to SCAMP4 versus shared with other family members

    • Solution: Create chimeric proteins exchanging domains between SCAMP4 and other SCAMP proteins

    • Experimental design: Domain-swapping experiments focusing on the unique aspects of SCAMP4 (lack of NPF repeats)

  • Protein-Protein Interaction Discrimination:

    • Challenge: Distinguishing SCAMP4-specific interaction partners from those shared among SCAMP family

    • Solution: Implement comparative interactome analysis across all SCAMP proteins using consistent methodology

    • Recommended technique: BioID proximity labeling with statistical analysis to identify significantly enriched SCAMP4 partners

  • Subcellular Localization Resolution:

    • Challenge: SCAMP proteins may colocalize in certain compartments while maintaining distinct distributions

    • Solution: Super-resolution microscopy techniques (STORM, PALM) to resolve spatial separation below diffraction limit

    • Quantitative approach: Develop colocalization coefficients specific for membrane proteins in contiguous compartments

How do post-translational modifications regulate bovine SCAMP4 function in different cellular contexts?

Post-translational modifications (PTMs) play critical roles in regulating bovine SCAMP4 function across various cellular contexts:

  • Ubiquitination Regulation:

    • Primary regulatory mechanism: Ubiquitination marks SCAMP4 for proteasomal degradation in proliferating cells

    • Key modification sites: Lysine residues K4 and K185 are primary ubiquitination targets

    • Cellular context dependence: Ubiquitination occurs rapidly in proliferating cells but is suppressed in senescent cells

    • Regulatory significance: This differential ubiquitination directly controls SCAMP4 protein levels and consequent secretory capacity

  • Phosphorylation Dynamics:

    • Predictive analysis: Bovine SCAMP4 contains multiple consensus phosphorylation sites for kinases including PKC, CK2, and MAPK

    • Functional implications: Phosphorylation likely regulates SCAMP4's interactions with trafficking machinery and membrane insertion

    • Context-dependent regulation: Phosphorylation states may vary between resting and stimulated cellular states

    • Research approach: Phospho-proteomic analysis combining mass spectrometry with phospho-specific antibodies

  • Palmitoylation Effects:

    • Structural role: Cysteine palmitoylation affects membrane association and protein stability

    • Regulatory mechanism: Dynamic palmitoylation/depalmitoylation cycles may regulate SCAMP4's subcellular distribution

    • Detection methods: Acyl-biotin exchange (ABE) or click chemistry approaches to identify palmitoylated SCAMP4

    • Functional significance: May regulate SCAMP4's association with specialized membrane domains or lipid rafts

  • Glycosylation Patterns:

    • Modification sites: Potential N-linked glycosylation sites in luminal loops between transmembrane domains

    • Tissue variation: Glycosylation patterns may differ between bovine tissue types (e.g., mammary vs. neural)

    • Functional effects: Glycosylation may affect protein folding, stability, and intercellular recognition

    • Analytical approaches: Lectin blotting and glycosidase digestion to characterize glycan structures

  • Integrated PTM Regulation:

    • Crosstalk mechanisms: Phosphorylation may regulate subsequent ubiquitination or vice versa

    • Cellular context integration: PTM patterns shift during cellular stress, differentiation, or senescence

    • Quantitative assessment: Mass spectrometry-based approaches to map the complete PTM landscape of SCAMP4

    • Experimental design: Compare PTM profiles between proliferating, senescent, and stressed bovine cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.