Recombinant Bovine Seipin (BSCL2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bovine Seipin, encoded by the BSCL2 gene, is a protein associated with lipid droplet biogenesis and a variety of human diseases . Mutations in the BSCL2 gene can result in Berardinelli-Seip congenital lipodystrophy type 2 (CGL2), progressive encephalopathy with or without lipodystrophy, and BSCL2-associated motor neuron diseases . Seipin's role extends to other conditions, including hepatic steatosis, neurodegenerative diseases, glioblastoma, stroke, and cardiac hypertrophy .

Gene and Protein Structure

The BSCL2 gene encodes the seipin protein, which resides in the endoplasmic reticulum membrane . Human seipin exists in two splice variants: a short form of 398 amino acids and a long form of 462 amino acids . These variants arise from three mRNA isoforms of 1.6 kb, 1.8 kb, and 2.2 kb . While both forms can be translated from the 1.8 kb and 2.2 kb mRNA, the longer form is more abundant . The 1.6 kb mRNA isoform exclusively translates the short form . Predominant expression of the 1.8 kb mRNA in the human brain suggests that the long form of seipin is the primary variant in this tissue .

Role in Adipogenesis

Seipin plays a crucial role in the development of mature adipocytes . Studies have shown that BSCL2 expression is strongly induced during adipocyte differentiation, and this induction is essential for adipogenesis to occur .

FeatureObservation
BSCL2 ExpressionStrongly induced during adipocyte differentiation
Key Adipogenic Transcription FactorsInitial induction preserved in cells lacking BSCL2, but expression not sustained
PPARγ ActivityImpaired in the absence of BSCL2
Genes Mediating Triglyceride SynthesisExpression persistently reduced, inhibiting lipid accumulation
BSCL2 MutantsPathogenic missense mutants, such as A212P, cause aberrant targeting of BSCL2 within the cell
R275X ProteinTruncated and not expressed in cells, suggesting individuals homozygous for this mutation may be effectively null for BSCL2 expression
A212P MutantExhibits aberrant accumulation in the nuclear envelope and is functionally inactive, failing to support adipose tissue formation in vivo

Seipin and Lipid Droplet Biogenesis

Seipin is known for its critical function in the biogenesis of lipid droplets . It regulates lipid droplet expansion and adipocyte development by modulating the activity of glycerol-3-phosphate acyltransferase (GPAT) . Seipin interacts with mammalian GPAT orthologs, GPAT3 and GPAT4 . Deficiency of seipin in yeast, mammalian cells, and mouse tissues results in increased GPAT activity and changes in GPAT kinetics .

Organism/Cell TypeObservation
fld1 null yeast cellsGPAT activity ~60% higher than in controls
Seipin -/- MEFsTotal and microsomal GPAT activities twice as high as in control MEFs
Seipin knockdown in 3T3L1 preadipocytesGPAT activity twice as high as in control preadipocytes
Bscl2 knockout mouse testesTotal, NEM-sensitive, and NEM-resistant GPAT activities increased

Seipin and Other Diseases

Mutations in BSCL2 are associated with a spectrum of diseases, including congenital generalized lipodystrophy (CGL) and distal hereditary motor neuropathy (dHMN) . The N152S and S154L missense mutations in seipin dominantly cause dHMN, characterized by the degeneration of motor nerve fibers .

Seipin and Pex30 Cooperation

Seipin cooperates with Pex30, a membrane-shaping protein, in organizing membrane domains for organelle budding . In yeast, Pex30 is enriched at LD budding sites in seipin mutants .

MutantObservation
fld1∆ and ldb16∆ cellsShow dramatic enrichment of Pex30-mNG in LD proximal regions
pex30∆fld1∆ and pex30∆ldb16∆ mutantsShow a unique dispersed Bodipy pattern of variable size, often occupying a large fraction of cellular area . Classical LD-like structures were virtually absent from the double mutant cells . Electron microscopy revealed highly convoluted ER membranes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for prioritized development.
Synonyms
BSCL2; Seipin; Bernardinelli-Seip congenital lipodystrophy type 2 protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-394
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
BSCL2
Target Protein Sequence
MVNDPPVPALLWAQEMGHVMAGRARKLLLQFGVFFCTILLLLWVSVFLYGSFYYSYMPTV SHLSPVHFHYRTDCESSTSLLCSFPVANVTLAKGGRDRVLMYGQPYRVTLELELPESPVN QDLGMFLVTISCYTRGGRIISTSSRSVMLHYRSSLLQMLDTLVFSSLLLFGFAEQKQLLE VELYPEYRENSYVPTTGAIIEIHSKRIQMYGAYLRIHAHFTGLRYLLYNFPMTCAFVGVA SNFTFLSVIVLFSYMQWVWGGIWPRQRLSLQVNIRNRKRSRKDIQRKVSAHQPGPQGQEE SPQLSPVTEDGESHADPSGTEGQLSEEEKTEQQPLSGEEELEPEASDGSGSWEDAALLTE ANLAASGSAPAPETVGSSEPSAGSVRQRPICSSS
Uniprot No.

Target Background

Function

Recombinant Bovine Seipin (BSCL2) plays a vital role in lipid droplet (LD) formation, key organelles for lipid and energy homeostasis. In conjunction with LDAF1, it defines LD formation sites within the endoplasmic reticulum (ER). It's also essential for the growth and maturation of nascent LDs into larger, mature LDs. Furthermore, it mediates the formation and/or stabilization of ER-LD contacts, facilitating protein and lipid transfer from the ER to developing LDs. BSCL2 regulates the maturation of ZFYVE1-positive nascent LDs and the function of the RAB18-ZFYVE1 complex in ER-LD contact formation. It binds anionic phospholipids, including phosphatidic acid, and significantly contributes to adipocyte differentiation and development.

Database Links
Protein Families
Seipin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lipid droplet.

Q&A

What is bovine seipin and how does it relate to human BSCL2?

Bovine seipin, like its human ortholog, is an integral membrane protein of the endoplasmic reticulum (ER) with no recognizable functional domains. In humans, loss-of-function mutations in SEIPIN/BSCL2 cause Berardinelli-Seip congenital lipodystrophy (BSCL), the most severe form of congenital lipodystrophy characterized by near-complete absence of adipose tissue . Bovine seipin shares high sequence homology with human seipin and likely performs similar functions in lipid droplet formation and adipocyte development. While specific research on bovine seipin is limited, studies in other mammalian models demonstrate its evolutionary conservation and importance in lipid metabolism regulation.

What cellular processes does bovine seipin regulate?

Bovine seipin plays crucial roles in multiple lipid-related cellular processes:

  • Lipid droplet biogenesis: Seipin defines the sites of lipid droplet formation in the ER, in association with LDAF1 (Lipid Droplet Assembly Factor 1) .

  • Lipid droplet growth: Seipin is required for the growth and maturation of small nascent lipid droplets into larger mature lipid droplets .

  • ER-lipid droplet contacts: Seipin mediates the formation and stabilization of endoplasmic reticulum-lipid droplet contacts, facilitating protein and lipid delivery from the ER into growing lipid droplets .

  • Adipocyte differentiation: Seipin plays an important role in the differentiation and development of adipocytes, as evidenced by the severe lipodystrophy in Seipin-deficient mice .

  • Lipid metabolism enzyme regulation: Seipin interacts with microsomal glycerol-3-phosphate acyltransferase (GPAT), influencing its activity and kinetics .

How does seipin function at the molecular level?

At the molecular level, seipin functions through multiple mechanisms:

  • Oligomerization: Seipin forms homo-oligomeric ring-like structures that create a scaffold at ER-lipid droplet contact sites.

  • Phospholipid binding: Seipin binds anionic phospholipids including phosphatidic acid, which may help concentrate specific lipids at sites of lipid droplet formation .

  • Protein-protein interactions: Seipin physically interacts with GPAT and influences its activity, with SEIPIN deficiency resulting in elevated GPAT activity and altered kinetic values .

  • Regulation of lipid synthesis pathways: Seipin regulates the glycerolipid synthesis pathway through its interactions with enzymes like GPAT, potentially serving as a molecular scaffold that organizes lipid metabolism at nascent lipid droplet formation sites .

What expression systems are recommended for producing recombinant bovine seipin?

When expressing recombinant bovine seipin, researchers should consider these options:

  • Mammalian expression systems: HEK293 or CHO cells are preferable for full-length bovine seipin expression to ensure proper post-translational modifications and membrane insertion.

  • Bacterial systems: E. coli can be used for expressing the luminal domain alone, ideally with solubility-enhancing fusion tags like MBP or SUMO.

  • Insect cell systems: Baculovirus-infected insect cells provide a good compromise between yield and proper folding.

Optimization considerations include:

  • Lower induction temperatures (16-18°C) for bacterial systems to minimize inclusion body formation

  • Codon optimization of the bovine sequence for the specific expression system

  • Addition of chaperones to enhance folding efficiency

  • Use of mild detergents for extraction from membranes

What are the most effective methods for studying bovine seipin-protein interactions?

To study bovine seipin interactions with other proteins (e.g., GPAT):

  • Co-immunoprecipitation: Using antibodies against epitope-tagged versions of both proteins, with careful selection of mild detergents (0.5-1% digitonin or 1% CHAPS) to preserve membrane protein interactions.

  • Proximity ligation assays: To visualize protein interactions in situ within cells.

  • FRET/BRET assays: For quantitative measurement of protein-protein interactions in living cells.

  • Yeast two-hybrid screening: Modified membrane yeast two-hybrid systems can identify novel interaction partners.

  • In vitro binding assays: Using purified components to establish direct interactions.

For studying seipin interaction with GPAT specifically, researchers should measure GPAT activity in seipin-deficient cells, as SEIPIN deficiency results in elevated GPAT activity with altered kinetic parameters . Reconstitution experiments with wild-type and mutant seipin can help determine which domains are essential for the interaction.

How should researchers design CRISPR-Cas9 experiments to study bovine BSCL2 function?

For CRISPR-Cas9 editing of bovine BSCL2:

  • gRNA design: Target conserved exonic regions (preferably exons 2-4) with multiple gRNAs to increase editing efficiency.

  • Delivery method: Nucleofection typically achieves 40-60% transfection efficiency in bovine primary cells.

  • Editing strategy:

    • For knockouts: Design gRNAs to create frameshift mutations early in the coding sequence

    • For specific mutations: Use homology-directed repair with templates containing at least 800bp homology arms

  • Validation methods:

    • Genomic PCR and sequencing to confirm mutations

    • RT-qPCR and western blotting to verify loss of expression

    • Functional assays to confirm phenotype (lipid droplet formation, adipogenesis)

To assess phenotypes in BSCL2 knockout bovine cells, analyze:

  • Lipid droplet morphology using BODIPY or Nile Red staining

  • Adipogenic marker expression (PPARγ, C/EBPα, FABP4)

  • Glycerolipid synthesis rates using metabolic labeling

  • GPAT activity assays, as SEIPIN deficiency results in elevated GPAT activity

How does seipin regulate lipid droplet formation and what methods best visualize this process?

Seipin regulates lipid droplet formation through several mechanisms:

  • Defining LD formation sites: In association with LDAF1, seipin determines where lipid droplets form in the ER .

  • Creating diffusion barriers: Seipin oligomers may form barriers that concentrate lipids at nascent LD formation sites.

  • Mediating ER-LD contacts: Seipin facilitates the formation of stable contacts between the ER and growing lipid droplets .

  • Regulating LD maturation: Seipin regulates the maturation of ZFYVE1-positive nascent LDs and facilitates the function of the RAB18-ZFYVE1 complex in establishing ER-LD contacts .

Methods to visualize these processes include:

  • Live-cell imaging with fluorescently tagged seipin and lipid droplet markers

  • Correlative light and electron microscopy (CLEM)

  • Super-resolution microscopy (STORM, PALM)

  • Electron tomography for 3D ultrastructural analysis of ER-LD contacts

  • FRAP (Fluorescence Recovery After Photobleaching) to study protein dynamics at LD formation sites

What is the relationship between seipin and GPAT, and how does this impact adipocyte development?

The relationship between seipin and GPAT (glycerol-3-phosphate acyltransferase) is fundamental to understanding adipocyte development:

  • Physical interaction: Seipin physically interacts with microsomal GPAT isoforms (GPAT3 and GPAT4) in multiple organisms .

  • Enzymatic regulation: Seipin negatively regulates GPAT activity, as evidenced by elevated GPAT activity in SEIPIN-deficient cells and tissues .

  • Kinetic modulation: SEIPIN deficiency alters GPAT kinetic values, suggesting direct enzymatic regulation .

  • Impact on adipogenesis: Increased GPAT activity appears to underpin the block in adipogenesis associated with SEIPIN loss .

This relationship is crucial because:

  • GPAT catalyzes the rate-limiting step in glycerophospholipid and triacylglycerol synthesis

  • Over-expression of Gpat3 blocks adipogenesis, similar to SEIPIN deficiency

  • Gpat3 knockdown in SEIPIN-deficient preadipocytes partially restores differentiation

  • Pharmacological inhibition of GPAT in Seipin−/− mouse preadipocytes partially restores adipogenesis

These findings suggest that GPAT inhibitors might be useful for treating human BSCL2 patients .

How does seipin function in brown adipose tissue compared to white adipose tissue?

Seipin functions differently in brown adipose tissue (BAT) compared to white adipose tissue (WAT):

  • Tissue distribution in knockout models:

    • Seipin-deficient (Bscl2−/−) mice display almost total loss of WAT with residual BAT present

    • This suggests differential requirements for seipin between tissue types

  • Thermogenic capacity:

    • Bscl2−/− mice display altered thermogenic capacity in BAT despite signs of remodeling

    • Under cold acclimation, Bscl2−/− mice can maintain body temperature when fed but not during fasting

  • Metabolic regulation:

    • Fasting worsens Bscl2−/− BAT properties at control temperature (21°C)

    • Bscl2−/− BAT shows obvious signs of insulin resistance

  • Cell-autonomous effects:

    • In brown adipocyte cell lines, seipin knockdown has minimal effect on adipocyte differentiation

    • This differs from the profound impact on white adipocyte differentiation

These findings suggest that BAT activity relies on WAT as an energetic substrate provider and adipokine-producing organ, highlighting the importance of the WAT/BAT dialogue for BAT integrity and its response to insulin and cold-activated adrenergic signals .

How can multiomics approaches enhance our understanding of bovine seipin function?

Multiomics approaches provide comprehensive insights into bovine seipin function:

  • Lipidomics:

    • Characterize changes in lipid species composition in seipin-deficient cells

    • Monitor alterations in phosphatidic acid levels, which are directly produced by GPAT activity

    • Identify lipid signatures associated with abnormal lipid droplet formation

  • Proteomics:

    • Identify seipin-interacting proteins through proximity labeling (BioID or APEX)

    • Map post-translational modifications of seipin using mass spectrometry

    • Profile changes in LD proteome composition in seipin-deficient cells

  • Transcriptomics:

    • Analyze gene expression changes during adipogenesis in seipin-deficient cells

    • Compare tissue-specific transcriptomes in different bovine fat depots

  • Metabolomics:

    • Track metabolic flux through glycerolipid synthesis pathways

    • Identify metabolic bottlenecks or alterations in seipin-deficient cells

Integration of these datasets can reveal:

  • Coordinated regulation of lipid metabolism pathways by seipin

  • Tissue-specific functions in different adipose depots

  • Metabolic adaptations to seipin deficiency

  • Novel therapeutic targets for lipodystrophy treatment

What are the critical differences between studying recombinant seipin in vitro versus its function in cellular contexts?

Researchers should be aware of several critical differences when studying recombinant seipin in vitro versus cellular contexts:

ParameterIn Vitro StudiesCellular Context
OligomerizationMay require specific detergents/lipids to maintainNaturally forms oligomers in ER membrane
Protein interactionsLimited to binary interactions with purified componentsComplex interaction network with multiple partners
Lipid environmentArtificial liposomes or nanodiscsNative ER membrane with physiological lipid composition
Post-translational modificationsTypically absent unless expressed in eukaryotic systemsDynamically regulated in response to cellular signals
Functional readoutsBiophysical measurements, enzymatic assaysLipid droplet formation, adipocyte differentiation
RegulationStatic conditionsDynamic regulation by cellular signaling pathways

To bridge these differences:

  • Use reconstitution systems that mimic cellular environments

  • Combine in vitro biochemical data with cellular validation

  • Develop cell-free systems that preserve native membrane contexts

  • Use complementary approaches to validate findings across systems

How might understanding bovine seipin function impact our approach to lipodystrophy-related disorders?

Understanding bovine seipin function has several potential impacts on lipodystrophy research:

  • Therapeutic target identification:

    • The seipin-GPAT interaction represents a potential therapeutic target, as GPAT inhibition partially restores adipogenesis in seipin-deficient cells

    • GPAT inhibitors might be useful for treating human BSCL2 patients

  • Mechanistic insights:

    • The finding that Bscl2-deficient BAT displays insulin resistance provides insights into the metabolic complications of lipodystrophy

    • Understanding the WAT/BAT dialogue reveals how adipose tissue loss affects thermogenesis

  • Model system development:

    • Bovine models can complement existing mouse models for studying species-specific aspects of lipodystrophy

    • Tissue-specific knockout approaches help distinguish primary from secondary effects of seipin deficiency

  • Comparative biology:

    • Studying seipin across species reveals evolutionarily conserved functions

    • Different susceptibilities to metabolic disease between species can highlight protective mechanisms

  • Biomarker identification:

    • Lipid profiling in seipin-deficient models may identify diagnostic or prognostic biomarkers for lipodystrophy

    • Potential biomarkers for monitoring treatment efficacy

What is the role of seipin in immune cell function, and how does this relate to infection susceptibility in lipodystrophy?

The relationship between seipin and immune function is complex:

  • Direct effects on immune cells:

    • Selective Bscl2 deficiency in macrophages does not critically impact the innate immune response to infection

    • Lipopolysaccharide-mediated stimulation of inflammatory cytokines is not impaired in macrophage-specific Bscl2 knockout mice (LysM-B2KO)

    • Intracellular fate and clearance of bacteria (S. aureus) in BSCL2-deficient bone marrow-derived macrophages is indistinguishable from controls

  • Indirect effects through metabolic dysregulation:

    • Increased susceptibility to infection in Congenital Generalized Lipodystrophy 2 (CGL2) patients likely results from severe metabolic disease rather than direct immune dysfunction

    • This suggests that the primary role of seipin in infection susceptibility is through its effects on adipose tissue and metabolism

  • Experimental evidence:

    • LysM-B2KO mice (with myeloid-specific Bscl2 deletion) and global Bscl2 knockout (SKO) mice show similar macrophage responses to inflammatory stimuli

    • The expression of pro-inflammatory (TNFα, IL-6, IL-1β) and anti-inflammatory (IL-10) cytokines is largely unchanged in seipin-deficient macrophages

These findings indicate that therapeutic approaches for infection susceptibility in lipodystrophy patients should focus on addressing metabolic abnormalities rather than targeting seipin function in immune cells directly.

How do different species-specific variants of seipin affect its function and interaction with GPAT?

Species-specific differences in seipin function and GPAT interaction are important considerations:

  • Evolutionary conservation:

    • Seipin-GPAT interaction is evolutionarily conserved from yeast to mammals

    • In yeast, Seipin (Fld1p) interacts with Gat1, a GPAT ortholog

    • In mammals, SEIPIN specifically interacts with GPAT3 and GPAT4

  • Functional conservation:

    • SEIPIN deficiency in yeast, mammalian cells, and mouse tissues all result in increased GPAT activity and changes in GPAT kinetics

    • This suggests the regulatory mechanism is preserved across species

  • Structural differences:

    • While the core luminal domain is highly conserved, N-terminal and C-terminal regions show greater variability between species

    • These differences may influence interaction strength or regulatory capacity

  • Experimental approaches:

    • Chimeric proteins containing domains from different species can identify critical interaction regions

    • Cross-species complementation experiments can assess functional conservation

    • Comparative binding studies with recombinant proteins can quantify interaction differences

Understanding these species-specific variations is crucial for translating findings from model organisms to human applications and for selecting appropriate experimental systems for bovine seipin research.

What are the most promising techniques for structural characterization of bovine seipin oligomers?

Structural characterization of bovine seipin oligomers requires specialized approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle cryo-EM has successfully determined structures of human seipin oligomers

    • For bovine seipin, similar approaches would require:

      • High-purity, detergent-solubilized protein

      • GraFix method to stabilize oligomers prior to grid preparation

      • Classification algorithms to handle heterogeneity in oligomer size

  • Integrative structural biology:

    • Combining multiple techniques:

      • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map oligomerization interfaces

      • Cross-linking mass spectrometry (XL-MS) to identify proximity relationships

      • Small-angle X-ray scattering (SAXS) for solution-state oligomer dimensions

      • Molecular dynamics simulations to model oligomer assembly

  • Advanced microscopy:

    • Super-resolution imaging of fluorescently labeled seipin in cells

    • Correlative light and electron microscopy (CLEM) to visualize oligomers in cellular context

    • Atomic force microscopy of reconstituted seipin oligomers in lipid bilayers

  • Functional validation:

    • Structure-guided mutagenesis to identify residues critical for oligomerization

    • Functional assays to correlate structural features with lipid droplet formation capacity

    • Comparative analyses between wild-type and oligomerization-defective mutants

These techniques, used in combination, can provide insights into how bovine seipin oligomers create the molecular scaffold necessary for lipid droplet formation and how structural alterations affect function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.