Recombinant Bovine Selenoprotein S (SELS)

Shipped with Ice Packs
In Stock

Description

Introduction

Selenoprotein S (SelS), also known as VIMP (VCP interacting membrane protein), is a selenocysteine-containing protein involved in endoplasmic reticulum (ER) function and inflammation . SelS participates in intracellular membrane transport and maintenance of diverse protein complexes by anchoring them to the endoplasmic reticulum membrane . Due to its various cellular functions, SelS genetic polymorphisms are associated with an increased risk for diseases such as diabetes, dyslipidemia, and cardiovascular diseases, while high expression levels correlate with poor prognosis in several cancers .

Structure and Function

SelS is a small, intrinsically disordered membrane protein associated with various cellular functions, including inflammatory processes, cellular stress response, protein quality control, and signaling pathways . It contains a short segment in the ER lumen and an extended cytoplasmic region . The cytoplasmic segment includes a disordered segment that contains the Sec residue and forms a selenenylsulfide bond with a nearby Cys . SelS mediates the interactions of the ERAD component Derlin-1 with p97, an AAA ATPase that pulls the protein targets to the cytoplasm, where they are broken down by the proteasome .

Role in ER-Associated Degradation (ERAD)

SelS is known for its contribution to the ER-associated degradation (ERAD) pathway, which governs the extraction of misfolded proteins or misassembled protein complexes from the ER to the cytosol for degradation by the proteasome . SelS participates in intracellular membrane transport and maintenance of protein complexes by anchoring them to the ER membrane .

Interaction with Multiprotein Complexes

SelS interacts with multiple protein complexes and participates in intracellular membrane transport and maintenance of these complexes by anchoring them to the ER membrane . Large-scale affinity isolation of human SelS and its mutant forms identified nearly two hundred additional proteins that were remarkably enriched for various multiprotein complexes . These interactions involved coiled-coil domains .

Selenomethionine and Selenoprotein Synthesis

Selenomethionine (SeMet) is an organic form of selenium that is more easily absorbed, metabolized, and retained in tissues than sodium selenite . Selenoprotein P (Sepp1), synthesized by the liver, transports selenium to plasma and consequently to the whole organism . Extrahepatic tissues uptake selenium primarily by endocytosis of Sepp1 mediated by the receptors apoER2 and megalin .

Association with Diseases

Genetic polymorphisms of SelS are associated with increased risk for diabetes, dyslipidemia, and cardiovascular diseases, while high expression levels correlate with poor prognosis in several cancers . Its inhibitory role in cytokine secretion is also exploited by viruses .

Data Table Example

GeneProteinFunctionDisease Association
SELSSelenoprotein SER-associated degradation, inflammatory processes, cellular stress response, protein quality controlDiabetes, dyslipidemia, cardiovascular diseases, cancer, cytokine secretion by viruses

Bioavailability of Selenium from Selenized Yeast

Studies in dairy cows indicated that supplementation with selenized yeast increased the levels of selenium in whole blood, plasma, and blood GSH-Px activity, demonstrating the bioavailability of selenium from Se-enriched yeast in lactating cows . Cows supplemented with selenized yeast had higher milk selenium concentration compared to non-microencapsulated sodium selenite .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SELENOS; Selenoprotein S; SelS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MERDGDQLSARPTLETEGLRFLHVTVGSLLATYGWYIVFSCILLYVVFQKLSTRLRALRQ RHLDQAAAALEPDIVVKRQEALAAARLKMQEELNAQVEKHKEKLRQLEEEKRRQKIEMWD SMQEGKSYKGNTRKPQEEDSPGPSTSSVIPKRKSDRKPLRGGGYNPLSGEGGGTCSWRPG RRGPSSGGUG
Uniprot No.

Target Background

Function
Recombinant Bovine Selenoprotein S (SELS) is involved in the degradation of misfolded endoplasmic reticulum (ER) luminal proteins. It facilitates the transfer of these misfolded proteins from the ER to the cytosol for proteasomal degradation via a ubiquitin-dependent pathway. SELS likely acts as a bridge between DERL1 (mediating retrotranslocation to the cytosol) and the VCP ATPase complex (mediating translocation and ubiquitination).
Database Links
Protein Families
Selenoprotein S family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cytoplasm.

Q&A

What is Selenoprotein S and what are its primary biological functions?

Selenoprotein S (SelS, also known as VIMP or SEPS1) is a selenocysteine-containing protein primarily located in the endoplasmic reticulum (ER) membrane. It serves multiple critical functions:

  • Acts as an intrinsically disordered membrane enzyme providing protection against reactive oxidative species

  • Participates in ER-associated protein degradation (ERAD) by linking derlin-1, a shuttle protein that removes misfolded proteins from the ER, to the p97 ATPase for proteasomal degradation

  • Plays important roles in inflammation regulation and ER stress response

  • Functions in maintenance and transport of protein complexes by anchoring them to the ER membrane

SelS is regulated by both inflammatory cytokines and ischemic conditions, with genetic studies showing that decreased SelS expression correlates with higher serum levels of inflammatory cytokines .

What expression systems are commonly used for recombinant selenoprotein production?

Several expression systems can be used for recombinant selenoprotein production, each with specific considerations:

  • E. coli expression systems:

    • Typically use BL21(DE3) cells with co-transformation of pSUABC (containing selA, selB, and selC genes) to provide the selenocysteine incorporation machinery

    • Require specific SECIS element design compatible with bacterial selenoprotein synthesis machinery

    • Laboratory-evolved recoded E. coli strains show improved fitness and superior selenoprotein production capacity

  • Mammalian cell systems:

    • HEK 293 and NIH 3T3 cells are commonly used for expression of selenoproteins with their native SECIS elements

    • Cotransfection with plasmids expressing SBP2 (SECIS binding protein 2) may improve selenoprotein expression

  • Cell-free expression systems:

    • Used for high-purity production of selenoproteins (≥85% purity)

    • Enables controlled incorporation of selenocysteine

The choice of expression system depends on the specific experimental needs, required protein yield, and the importance of post-translational modifications.

How is selenocysteine incorporation achieved during recombinant selenoprotein production?

Selenocysteine (Sec) incorporation is a specialized process requiring specific molecular machinery:

  • Key components required:

    • UGA codon in the mRNA (normally a stop codon) to specify selenocysteine insertion

    • A Sec insertion sequence (SECIS) element, which is a secondary structure in the mRNA

    • Selenocysteine-specific tRNA (tRNA^[Ser]Sec)

    • Translation factors including SECIS binding protein 2 (SBP2) and selenocysteine-specific elongation factor (eEFSec in eukaryotes, SelB in bacteria)

  • Bacterial vs. mammalian systems:

    • In bacteria, the SECIS element is located immediately downstream of the UGA codon

    • In eukaryotes, the SECIS element is found in the 3' untranslated region (3' UTR)

    • Bacterial SelB directly recognizes SECIS, while eukaryotes require SBP2 and eEFSec

  • Expression optimization:

    • Induction at late exponential phase (OD600 ~2.4) with continued growth at 24°C for 24h yields higher selenoprotein production in bacterial systems

    • Addition of sodium selenite (2 μM) 1 hour before induction improves selenocysteine incorporation

This complex machinery explains why selenoprotein production is often challenging and requires specialized experimental approaches.

What strategies can overcome the typical low efficiency of selenocysteine incorporation?

The incorporation of selenocysteine is inherently inefficient, but several strategies can improve yields:

These strategies can be combined to maximize both the total yield and the proportion of full-length selenoprotein containing selenocysteine.

How can researchers distinguish between selenocysteine-containing and truncated forms of recombinant Selenoprotein S?

Distinguishing between full-length selenocysteine-containing SelS and truncated forms is crucial for experimental validity:

  • Activity-based methods:

    • Selenocysteine-containing forms typically show higher enzymatic activity than truncated forms or Cys-substituted variants

    • For Selenoprotein S, thioredoxin-dependent reductase activity can be measured, as SelS is primarily a thioredoxin-dependent reductase

    • Specific activity measurements can serve as a proxy for selenocysteine incorporation efficiency

  • Analytical techniques:

    • Mass spectrometry to detect the mass difference between selenocysteine (168.05 Da) and premature termination or cysteine substitution (121.16 Da)

    • Western blotting with antibodies specific to the C-terminal region (if the selenocysteine is near the C-terminus)

    • Metabolic labeling with 75Se followed by SDS-PAGE and phosphorimaging visualization

  • Genetic approaches:

    • Comparison with Sec-to-Cys mutants, which typically show higher expression but lower activity

    • Use of seleno-smURFP reporter systems that fluoresce only when selenocysteine is incorporated

A comprehensive approach combining activity measurements with direct analytical detection provides the most reliable assessment of selenocysteine incorporation.

What are the critical parameters affecting the stability and functionality of recombinant Selenoprotein S?

Several factors influence the stability and functionality of recombinant SelS:

  • Structural considerations:

    • SelS contains an intrinsically disordered region (residues 123-189 out of 189) that includes the selenocysteine at position 188

    • The selenocysteine forms a selenenylsulfide bond with a nearby cysteine (Cys174)

    • SelS dimerizes through a coiled-coil region, which is essential for its function

  • Buffer and storage conditions:

    • Presence of reducing agents must be carefully controlled as they can disrupt the selenenylsulfide bond

    • Oxidative conditions can lead to irreversible oxidation of selenocysteine

    • pH stability range may be narrower than for non-selenoproteins

    • Storage at -80°C with appropriate cryoprotectants is recommended

  • Post-translational modifications:

    • Proper membrane insertion is critical for function, as SelS is a single-pass transmembrane protein

    • Interaction with binding partners (p97, Derlin-1, etc.) may stabilize the protein

  • Experimental handling:

    • Minimize freeze-thaw cycles

    • Use anaerobic conditions when possible during purification

    • Consider detergent selection carefully for this membrane protein

Understanding these parameters is essential for maintaining the structural integrity and biological activity of recombinant SelS.

How does the selenoproteome expression profile vary across different bovine tissues and how might this impact SELS function?

The selenoprotein expression profile varies significantly across bovine tissues, affecting SELS function:

This tissue-specific expression pattern suggests that SELS function may be contextually regulated within the broader selenoproteome network.

What techniques can be employed to study the protein-protein interactions of recombinant Selenoprotein S?

Multiple complementary approaches can be used to investigate SelS protein-protein interactions:

  • Large-scale affinity isolation:

    • Pull-down experiments with tagged recombinant SelS followed by mass spectrometry have identified nearly 200 interacting proteins

    • Comparative analysis with mutant forms of SelS can help identify specific interaction domains

  • Chemical cross-linking approaches:

    • Cross-linking experiments have confirmed interactions between SelS and components of different multi-protein complexes

    • These experiments revealed the importance of the SelS conserved coiled-coil domain in protein interactions

  • Co-immunoprecipitation:

    • For validation of specific interactions (e.g., with Derlin-1, p97, UBXD8)

    • Can be performed with antibodies against the native protein or epitope tags

  • Fluorescence microscopy techniques:

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • These approaches allow visualization of interactions in living cells

  • Surface plasmon resonance:

    • For quantitative measurement of binding kinetics and affinity constants

    • Particularly useful for analyzing the interactions of recombinant SelS with purified partner proteins

These techniques have revealed that SelS interacts with components of the ERAD machinery (Derlin-1, p97), selenoprotein K (SelK), and various other proteins involved in ubiquitination and membrane transport .

What are the optimal culture conditions for maximizing recombinant bovine SELS production in bacterial systems?

Based on extensive research, the following optimized protocol can significantly improve recombinant SELS production:

  • Host strain selection:

    • BL21(DE3) cells cotransformed with pSUABC (containing selA, selB, and selC genes)

    • Laboratory-evolved recoded E. coli strains developed for selenoprotein production show 5-7 fold increased expression

  • Growth medium composition:

    • LB medium containing 100 μg/ml ampicillin and 34 μg/ml chloramphenicol (for maintaining pSUABC plasmid)

    • Glucose-containing media appears beneficial for selenoprotein synthesis

  • Growth and induction protocol:

    • Grow cells at 37°C until OD600 reaches ~2.4 (late exponential phase)

    • Add sodium selenite (2 μM) 1 hour before induction

    • Induce protein expression with 0.1 mM IPTG

    • Continue expression at 24°C for 24 hours

  • Purification considerations:

    • Use tag systems (His-tag, GST) for easier purification

    • Include reducing agents (e.g., β-mercaptoethanol or DTT) in appropriate concentrations to prevent oxidation of selenocysteine

    • Consider using anaerobic conditions during purification steps

This optimized protocol has been shown to yield approximately 20 mg of selenoprotein per liter of bacterial culture with specific activity around 50% of the native enzyme .

How can researchers effectively validate the functional integrity of recombinant bovine SELS?

A comprehensive validation approach should include:

  • Enzymatic activity assays:

    • Thioredoxin-dependent reductase activity assays (SelS is primarily a thioredoxin-dependent reductase)

    • Hydrogen peroxide reduction assay (although SelS is not an efficient peroxidase)

    • Specific activity measurements compared to native bovine SELS

  • Structural validation:

    • Circular dichroism spectroscopy to assess secondary structure elements

    • Mass spectrometry to confirm selenocysteine incorporation

    • Size-exclusion chromatography to assess oligomeric state (SelS forms dimers through its coiled-coil region)

  • Functional assays:

    • ER stress response assays (SelS is upregulated during ER stress)

    • Protein degradation assays to assess ERAD function

    • Interaction studies with known binding partners (p97, Derlin-1)

  • Cell-based validation:

    • Rescue experiments in SelS-knockdown cell lines

    • Localization studies to confirm proper ER membrane targeting

    • Protection against ER stress-induced apoptosis

A fully functional recombinant bovine SELS should demonstrate proper enzymatic activity, structural integrity, and biological function comparable to the native protein.

What are the main differences between producing selenoprotein S in bacterial versus mammalian expression systems?

The choice between bacterial and mammalian expression systems involves several important considerations:

ParameterBacterial Expression SystemMammalian Expression System
Selenocysteine incorporation mechanismRequires engineered SECIS element compatible with bacterial machinery; SelB directly recognizes SECIS Uses native SECIS elements in 3' UTR; requires SBP2 and eEFSec
Co-expression requirementsTypically requires co-transformation with pSUABC for selA, selB, and selC genes May benefit from co-expression of SBP2
YieldCan achieve ~20 mg selenoprotein/L culture with optimized conditions Generally lower yields but better post-translational modifications
Post-translational modificationsLimited; lacks glycosylation and proper disulfide bond formationNative-like modifications; proper folding environment
Membrane protein considerationsChallenging for membrane proteins like SelS; may require detergent solubilizationBetter for membrane proteins; provides proper ER targeting
Induction controlTight control with IPTG or arabinose-inducible promotersInducible systems available but generally less stringent control
Production timeRelatively fast (24-48 hours)Longer (days to weeks)
Culture complexitySimpler media and growth conditionsMore complex media requirements; sterile conditions
Codon usageMay require optimization for mammalian proteinsNatural codon usage for mammalian proteins

For functional studies of bovine SELS, mammalian systems may provide more physiologically relevant results, while bacterial systems offer advantages for structural studies requiring larger protein quantities.

What techniques can be used to study the role of Selenoprotein S in endoplasmic reticulum stress response?

Several methodological approaches can elucidate the role of SelS in ER stress response:

  • ER stress induction and monitoring:

    • Treatment with tunicamycin, thapsigargin, or DTT to induce ER stress through distinct mechanisms

    • Monitor SelS mRNA and protein upregulation during ER stress (significant increases have been observed)

    • Assess XBP1 splicing as an ER stress marker alongside SelS expression

  • Loss-of-function approaches:

    • siRNA knockdown of SelS followed by analysis of ER stress markers (BiP, CHOP, XBP1s)

    • CRISPR/Cas9-mediated knockout in cell lines or animal models

    • Assessment of unfolded protein response (UPR) pathway activation

  • Rescue experiments:

    • Reintroduction of wild-type or mutant forms of recombinant SelS into knockdown/knockout systems

    • Comparison of Sec-containing versus Cys-substituted forms of SelS

  • Protein degradation assays:

    • Pulse-chase experiments to measure turnover of ERAD substrates

    • Ubiquitination assays to assess ERAD function

    • Co-immunoprecipitation with ERAD components during ER stress

  • Live cell imaging:

    • Fluorescently tagged SelS to monitor localization changes during ER stress

    • Assessment of ER morphology in SelS-deficient cells

These approaches have revealed that SelS is upregulated during ER stress and protects against ER stress-induced apoptosis by facilitating the removal of misfolded proteins from the ER .

How does the presence of selenocysteine versus cysteine affect the structural and functional properties of Selenoprotein S?

The selenocysteine residue in SelS provides distinct properties compared to cysteine substitution:

  • Chemical properties comparison:

    • Selenocysteine has a lower pKa (~5.2) compared to cysteine (~8.3), making it a better nucleophile at physiological pH

    • The larger atomic radius of selenium creates different bond lengths and geometries

    • Selenocysteine-containing enzymes typically show higher catalytic efficiency

  • Functional differences:

    • Only the selenocysteine-containing form of SelS is enzymatically active as a thioredoxin-dependent reductase

    • Cys-substituted forms show significantly reduced or absent enzymatic activity

    • Studies with recombinant selenoproteins show that Sec-to-Cys mutations generally preserve partial activity, while other mutations completely disrupt function

  • Structural implications:

    • The selenocysteine at position 188 forms a selenenylsulfide bond with Cys174

    • This bond is critical for the redox function of SelS

    • Cysteine substitution would alter this redox-active center

  • Expression considerations:

    • Cys-substituted forms of selenoproteins generally express at higher levels than their Sec-containing counterparts

    • This is due to the inefficiency of the selenocysteine insertion machinery compared to standard translation

Understanding these differences is crucial when designing experiments with recombinant SelS and interpreting results from Cys-substituted mutants.

What is the current understanding of Selenoprotein S regulation in the context of the wider bovine selenoproteome?

Recent research provides insights into SelS regulation within the bovine selenoproteome:

  • Selenium form-dependent regulation:

    • In bovine liver tissue, mixed (1:1 inorganic:organic) selenium supplementation increased SELENOS expression by 44%

    • Different forms of selenium supplementation (inorganic, organic, or mixed) affect the expression patterns of various selenoproteins

  • Tissue-specific regulation:

    • RT-PCR analysis detected 24 of 25 known selenoproteins (except SELENOH) in both bovine pituitary and liver tissues

    • Expression levels and responses to selenium supplementation vary between tissues

  • Hierarchy in selenoprotein expression:

    • During selenium deficiency, a hierarchy exists in selenoprotein expression, with essential selenoproteins maintained at the expense of others

    • This hierarchy is regulated partly by the differential affinity of SECIS elements for SBP2 and other SECIS-binding proteins

    • Under selenium-deficient conditions, cysteine can be biosynthesized de novo using the selenocysteine biosynthetic machinery and inserted into selenoproteins

  • Regulatory interactions:

    • Multiple SECIS-binding proteins (SBP2, nucleolin, eIF4a3, L30) likely regulate selenoprotein expression in a combinatorial manner

    • These interactions may contribute to tissue-specific regulation of SELS expression

This understanding of selenoprotein regulation provides a framework for interpreting SelS function within the broader context of selenium metabolism in cattle.

How can researchers accurately quantify selenocysteine incorporation efficiency in recombinant bovine Selenoprotein S?

Multiple complementary approaches can be used to quantify selenocysteine incorporation:

  • Radioisotope labeling methods:

    • Metabolic labeling with 75Se followed by SDS-PAGE and phosphorimaging

    • Quantification of 75Se incorporation relative to total protein

    • This approach directly measures selenocysteine incorporation without interference from truncated forms

  • Mass spectrometry-based approaches:

    • High-resolution mass spectrometry to determine the ratio of full-length Sec-containing protein to truncated forms

    • Multiple reaction monitoring (MRM) or parallel reaction monitoring (PRM) for targeted quantification

    • Isotope-labeled synthetic peptides can serve as internal standards

  • Activity-based quantification:

    • Specific activity measurements compared to a reference standard of native bovine SELS

    • For thioredoxin reductase, a specific activity of 50% of the native enzyme indicates approximately 50% selenocysteine incorporation

  • Fluorescent reporter systems:

    • Seleno-smURFP reporter systems that generate red fluorescence only when selenocysteine is successfully incorporated

    • Quantification of fluorescence intensity provides a measure of incorporation efficiency

  • N-terminal sequencing:

    • Direct sequencing to identify the ratio of selenocysteine versus truncated forms

    • This approach is particularly useful for proteins with selenocysteine near the C-terminus

A combination of these methods provides the most comprehensive assessment of selenocysteine incorporation efficiency.

What challenges exist in scaling up recombinant bovine SELS production for structural biology applications?

Scaling up recombinant bovine SELS production for structural studies faces several challenges:

  • Selenocysteine incorporation efficiency:

    • Maintaining high selenocysteine incorporation efficiency at scale is difficult

    • Competition between selenocysteine insertion and translation termination at the UGA codon becomes more problematic in larger cultures

    • The stoichiometry between mRNA, the SelB elongation factor, and release factor 2 (RF2) becomes critical

  • Expression system limitations:

    • Bacterial systems may produce inclusion bodies at high expression levels

    • Mammalian systems face scalability issues and higher costs

    • Maintaining optimal induction timing (OD600 ~2.4) in large-scale cultures requires precise monitoring

  • Purification challenges:

    • SelS is a membrane protein, requiring detergent solubilization

    • The intrinsically disordered region (residues 123-189) complicates structural studies

    • Maintaining selenocysteine redox state during purification requires careful buffer optimization

  • Structural characterization difficulties:

    • The membrane-associated nature of SELS complicates crystallization

    • The intrinsically disordered regions are challenging for X-ray crystallography

    • Cryo-EM may be more suitable but requires larger amounts of homogeneous protein

  • Stability considerations:

    • Selenoproteins are sensitive to oxidation during long-term storage

    • The selenenylsulfide bond between Sec188 and Cys174 must be maintained in the proper redox state

Addressing these challenges may require combinatorial approaches, including engineered expression hosts, optimized culture conditions, and specialized purification strategies.

How can recombinant Selenoprotein S be utilized to study ER-associated protein degradation mechanisms?

Recombinant SelS provides valuable tools for investigating ERAD mechanisms:

  • Protein complex reconstitution:

    • In vitro reconstitution of the Derlin-1/p97/SelS complex using purified recombinant components

    • Analysis of the stoichiometry and assembly dynamics of these complexes

    • Structure-function studies of the ERAD machinery

  • ERAD substrate processing assays:

    • Using recombinant SelS in cell-free systems to study the extraction and degradation of model ERAD substrates

    • Tracking the movements of fluorescently labeled ERAD substrates in the presence or absence of functional SelS

  • Interaction mapping:

    • Chemical cross-linking coupled with mass spectrometry to identify interaction sites between SelS and other ERAD components

    • These experiments have already revealed that most SelS interactions involve coiled-coil domains

    • Mutagenesis studies to identify critical residues for specific protein-protein interactions

  • Functional rescue experiments:

    • Introduction of recombinant wild-type or mutant SelS into SelS-deficient cells

    • Assessment of ERAD substrate degradation rates

    • Complementation assays with selenocysteine versus cysteine variants to determine the importance of the selenocysteine residue

  • Structural studies:

    • Cryo-EM analysis of SelS-containing membrane protein complexes

    • Structural determination of SelS in complex with ERAD components

    • These studies would provide insights into how SelS anchors the ERAD machinery to the ER membrane

These approaches have revealed that SelS participates in intracellular membrane transport and maintenance of protein complexes by anchoring them to the ER membrane .

What experimental approaches can elucidate the role of Selenoprotein S in inflammatory processes?

Several experimental strategies can investigate SelS's role in inflammation:

  • Cytokine-induced expression studies:

    • Treatment of bovine cells with inflammatory cytokines (TNF-α, IL-1β, IL-6) to assess SelS upregulation

    • Time-course and dose-response analyses to characterize the inflammatory regulation of SelS

    • Comparison with other inflammation-responsive selenoproteins

  • Loss-of-function approaches:

    • siRNA knockdown or CRISPR/Cas9 knockout of SelS in bovine cell lines

    • Assessment of inflammatory cytokine production and signaling

    • Genetic studies have shown that a promoter polymorphism decreasing SelS expression correlates with higher serum levels of inflammatory cytokines

  • Structure-function studies with recombinant proteins:

    • Site-directed mutagenesis to identify domains involved in inflammatory regulation

    • Comparison of wildtype SelS versus selenocysteine-to-cysteine mutants in inflammatory response assays

  • Cell-based inflammation models:

    • LPS stimulation of macrophages with or without recombinant SelS supplementation

    • Measurement of NF-κB activation and inflammatory cytokine production

    • Assessment of ER stress markers during inflammation

  • Ex vivo tissue models:

    • Precision-cut tissue slices from bovine tissues treated with inflammatory stimuli

    • Analysis of SelS expression and inflammatory markers

    • Testing recombinant SelS as an anti-inflammatory intervention

These approaches can help determine whether the anti-inflammatory effects of SelS are directly linked to its role in ER stress management or represent an independent function.

What insights can be gained from comparing recombinant bovine SELS with SELS from other species?

Comparative studies offer valuable insights into the evolution and function of SELS:

  • Sequence and structure comparison:

    • Analysis of conserved domains across species (human, bovine, rodent, etc.)

    • The coiled-coil domain and VCP-interacting motif are highly conserved

    • The position of the selenocysteine residue near the C-terminus is maintained across vertebrates

  • Functional conservation assessment:

    • Cross-species complementation studies in knockout cell lines

    • Comparison of enzymatic activities and protein-protein interactions

    • Evaluation of tissue-specific expression patterns

  • Evolutionary insights:

    • Some insects lack the selenocysteine biosynthesis machinery but contain orthologs of selenoprotein synthesis proteins like SPS1, suggesting these proteins may have functions unrelated to selenoprotein synthesis

    • Understanding the selenoprotein gene family evolution provides context for SELS function

  • Species-specific regulation:

    • Different selenium requirements and metabolism across species

    • Comparison of SECIS element structures and efficiency

    • Analysis of promoter regions to identify conserved regulatory elements

  • Disease-related variations:

    • Analysis of natural variants and polymorphisms across species

    • Association of SELS variants with species-specific pathologies

    • These comparisons may reveal why certain SELS-related conditions affect some species but not others

Comparative studies have already revealed important insights, such as the finding that SPS1 functions in a pathway unrelated to selenoprotein synthesis in some organisms .

How can CRISPR/Cas9 gene editing be combined with recombinant protein studies to understand SELS function?

Integrating CRISPR/Cas9 gene editing with recombinant protein studies creates powerful research approaches:

  • Endogenous tagging strategies:

    • CRISPR/Cas9-mediated knock-in of epitope tags or fluorescent proteins to study native SELS

    • Comparison with recombinant protein behavior to validate experimental systems

    • Analysis of protein-protein interactions in their native context

  • Domain-specific mutations:

    • CRISPR/Cas9-induced point mutations in specific SELS domains

    • Parallel studies with similarly mutated recombinant proteins

    • These complementary approaches can validate structure-function relationships

  • Selenocysteine-specific investigations:

    • CRISPR/Cas9 editing to convert the endogenous selenocysteine codon to cysteine

    • Comparison with recombinant Sec-to-Cys mutant proteins

    • Assessment of cellular phenotypes under normal and stress conditions

  • Rescue experiments:

    • CRISPR/Cas9 knockout of SELS followed by complementation with recombinant variants

    • Quantitative assessment of functional rescue

    • Structure-function analysis through systematic mutation

  • Regulatory element manipulation:

    • CRISPR/Cas9 editing of SECIS elements or promoter regions

    • Correlation with recombinant expression systems using the same modifications

    • These approaches can elucidate the regulation of SELS expression

This integrated approach provides more robust evidence than either technique alone and addresses potential artifacts from overexpression or non-physiological conditions.

How might recombinant Selenoprotein S be used to develop therapeutic interventions for ER stress-related diseases?

Recombinant SelS offers potential therapeutic applications for ER stress-related conditions:

  • Therapeutic protein development:

    • Engineering stabilized forms of recombinant SelS for potential protein therapy

    • Development of cell-penetrating SelS variants to enhance ER stress response

    • SelS has been shown to reduce endoplasmic reticulum stress-induced apoptosis

  • Drug target identification:

    • Use of recombinant SelS in high-throughput screening assays to identify compounds that enhance its activity

    • Structure-based drug design targeting specific SelS interactions or functions

    • These approaches could yield small molecules that modulate SelS activity

  • Biomarker development:

    • Recombinant SelS as a standard for developing quantitative assays of SelS in clinical samples

    • Assessment of SelS as a potential biomarker for ER stress-related conditions

    • Correlation of SelS levels or variants with disease progression

  • Gene therapy approaches:

    • Development of gene delivery systems for SelS overexpression

    • CRISPR/Cas9-mediated correction of SELS mutations

    • Testing in cellular and animal models of ER stress-related diseases

  • Neurodegenerative disease applications:

    • SelS is involved in removal of misfolded proteins from the ER and could function to remove amyloid-β and tau to prevent the buildup of amyloid plaques and neurofibrillary tangles in Alzheimer's disease

    • Development of SelS-based approaches to enhance clearance of misfolded proteins in neurodegenerative disorders

The protective role of SelS against ER stress makes it a promising therapeutic target for conditions involving protein misfolding and ER dysfunction.

What alternative methods could improve selenocysteine incorporation efficiency in recombinant bovine SELS?

Several innovative approaches may enhance selenocysteine incorporation:

  • Genetic code expansion approaches:

    • Development of orthogonal tRNA/synthetase pairs specifically for selenocysteine

    • This would bypass the natural UGA-dependent selenocysteine insertion machinery

    • Potential for site-specific incorporation at positions beyond the natural selenocysteine site

  • Selenocysteine insertion machinery engineering:

    • Directed evolution of key components (SelB, SBP2) for improved efficiency

    • Laboratory evolution of recoded E. coli strains has already shown 5-7 fold increases in selenoprotein expression

    • Engineering SECIS elements for improved binding to insertion machinery components

  • Chemical biology approaches:

    • Protein semi-synthesis using native chemical ligation with synthetic selenocysteine-containing peptides

    • Incorporation of selenocysteine analogs with enhanced stability

    • These approaches would circumvent the biological limitations of selenocysteine insertion

  • In vitro translation systems:

    • Development of specialized cell-free translation systems optimized for selenoprotein synthesis

    • Precise control over component stoichiometry to favor selenocysteine insertion over termination

    • A recent study has shown that known core factors are sufficient for Sec incorporation in a plant in vitro translation system

  • Selenium source optimization:

    • Testing alternative selenium compounds beyond sodium selenite

    • Optimization of selenium concentration and timing of addition

    • Investigation of selenium metabolism pathways to maximize selenophosphate availability

These alternative approaches could significantly advance the field of recombinant selenoprotein production.

How can systems biology approaches integrate selenoprotein S function within the broader cellular stress response network?

Systems biology offers comprehensive frameworks for understanding SelS function:

  • Multi-omics integration:

    • Combination of transcriptomics, proteomics, and metabolomics data from SelS manipulation studies

    • Network analysis to identify key interaction partners and pathways

    • These approaches can reveal unexpected connections between SelS and other cellular systems

  • Mathematical modeling:

    • Development of computational models of the ER stress response incorporating SelS function

    • Simulation of different stress conditions and SelS expression levels

    • Prediction of system-level outcomes for experimental validation

  • Interactome mapping:

    • Comprehensive protein-protein interaction studies using techniques like BioID or APEX proximity labeling

    • Integration with known interactome data for ERAD and inflammation pathways

    • Affinity isolation of SelS followed by mass spectrometry has already identified nearly two hundred interacting proteins

  • Pathway impact analysis:

    • Assessment of how SelS perturbation affects multiple interconnected cellular pathways

    • Quantification of information flow through signaling networks with or without functional SelS

    • Identification of critical nodes that mediate SelS-dependent phenotypes

  • Comparative species analysis:

    • Cross-species comparison of selenoprotein networks

    • Identification of conserved vs. species-specific aspects of SelS function

    • Evolutionary insights into the integration of selenoproteins into stress response systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.