Recombinant Bovine Serine protease HTRA2, mitochondrial (HTRA2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bovine Serine Protease HTRA2, mitochondrial (HTRA2), also known as HtrA serine peptidase 2, is a serine protease that plays a crucial role in mitochondrial quality control and apoptosis . HTRA2 is essential for maintaining mitochondrial homeostasis and neuronal cell survival . The protease is found in various organisms, including humans, mice, and bovines, with high sequence homology, indicating conserved functions .

Functional Role and Mechanisms

HTRA2 is involved in several critical cellular processes:

  • Mitochondrial Quality Control: HTRA2 functions similarly to DegP in bacteria, monitoring and regulating protein folding within the mitochondria . Loss of HTRA2 leads to compromised mitochondrial respiration and accumulation of unfolded proteins and peroxidized lipids .

  • Apoptosis: HTRA2 participates in both caspase-dependent and independent apoptotic pathways . Its serine protease activity promotes apoptosis, and it facilitates the degradation of mutant proteins through autophagy .

  • Autophagy Regulation: HTRA2 regulates autophagy by digesting HAX-1, a protein of the Bcl-2 family, which represses autophagy in a Beclin-1-dependent manner .

  • Inflammation Modulation: HTRA2 influences macrophage polarization by affecting macrophage energy metabolism and inhibiting STAT3, thereby improving rheumatoid arthritis (RA) .

HTRA2 in Neurodegenerative Disorders

HTRA2 has been linked to several neurodegenerative disorders, including Parkinson's disease and Alzheimer's disease .

  • Parkinson's Disease: Mutations in HTRA2 are associated with Parkinson's disease . Studies have shown that a specific mutation (p.G399S) in HTRA2 leads to mitochondrial dysfunction and altered morphology . Homozygosity for this mutation is linked to an earlier onset of tremor, a common symptom of Parkinson's .

  • Alzheimer's Disease: HTRA2 protein activity is increased in the brain tissues of Alzheimer's disease patients, promoting neuroprotection by enhancing autophagic processes and facilitating the degradation of mutant proteins such as A53T α-synuclein .

HTRA2-Specific Protein Interactions

HTRA2 interacts with various proteins in the retina, playing a role in neurological tissues. Significant protein interaction partners identified include proteins involved in ER to Golgi anterograde transport (e.g., AP3D1), aggrephagy (e.g., PSMC1), and the pyruvate metabolism/citric acid cycle (e.g., SHMT2) .

Table 1: Significant Protein Interaction Partners of HTRA2

ProteinFunction
AP3D1ER to Golgi anterograde transport
PSMC1Aggrephagy
SHMT2Pyruvate metabolism/citric acid cycle

Impact of HTRA2 Deficiency

Loss of HTRA2 function results in several detrimental effects:

  • Mitochondrial Stress: HTRA2 deficiency increases sensitivity to mitochondrial stress, leading to enhanced transcriptional responses and increased levels of reactive oxygen species (ROS) .

  • Respiratory Dysfunction: Absence of HTRA2 results in generalized respiratory dysfunction, affecting normal electron transport through the respiratory chain .

  • Increased ROS Production: HTRA2 knockout cells show increased levels of ROS, leading to oxidative damage and activation of stress response-specific genes .

HTRA2 and Cardiac Function

Studies in mice have indicated that HTRA2 deficiency leads to cardiac enlargement and left ventricular hypertrophy, associated with increased autophagosome activity in cardiac tissue . Mitochondrial proteins such as PPID and SOD2 are degraded at an increased rate in HTRA2-expressing cells under starvation conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
HTRA2; Serine protease HTRA2, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
134-458
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
SVLGSPPTSPRSQYNFIADVVEKTAPAVVYIEILGRHPFSGREVPISNGSGFVVAADGLI VTNAHVVADRRRVRVRLPSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQ GEFVVAMGSPFALQNTITSGIVSSAQRPAKDLGLPQTNVEYIQTDAAIDFGNSGGPLVNL DGEVIGVNTMKVTSGISFAIPSDRLREFLHRGEKKNSWFGISGSQRRYIGVMMLTLTPSI LAELQLREPSFPDVQHGVLIHKVILDSPAHRAGLRPGDVILAIGEQLVQNAEDIYEAVRT QSQLAVRIRRGQETLTLYVTPEVTE
Uniprot No.

Target Background

Function
Recombinant Bovine Serine protease HTRA2, mitochondrial (HTRA2) is a serine protease exhibiting non-specific proteolytic activity against beta-casein. It induces cell death through two mechanisms: 1) direct binding and inhibition of BIRC proteins (inhibitor of apoptosis proteins, IAPs), leading to increased caspase activity; and 2) a BIRC-independent, caspase-independent mechanism reliant on its serine protease activity. Furthermore, it cleaves and promotes the degradation of THAP5 during apoptosis.
Database Links
Protein Families
Peptidase S1C family
Subcellular Location
Mitochondrion intermembrane space. Mitochondrion membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.