Recombinant Bovine Short-chain dehydrogenase/reductase 3 (DHRS3)

Shipped with Ice Packs
In Stock

Description

Introduction to DHRS3

DHRS3, also known as retinal short-chain dehydrogenase/reductase 1 (retSDR1), belongs to the short-chain dehydrogenase/reductase (SDR) family of enzymes . This protein family catalyzes the oxidation/reduction of various substrates, including retinoids and steroids . DHRS3 has received significant attention in developmental biology due to its essential role in regulating the levels of retinoic acid, a crucial morphogen that influences numerous developmental processes including embryonic patterning and organogenesis .

The bovine variant of DHRS3 shares significant structural and functional homology with its counterparts in other mammalian species, making it a valuable model for studying retinoid metabolism across species . As a key enzyme in vitamin A metabolism, DHRS3 contributes to the fine balance of retinoic acid levels, which is critical for normal development, as both excess and deficiency of retinoic acid can lead to developmental abnormalities .

Protein Structure and Classification

Bovine DHRS3 is classified under EC 1.1.1.300 and is recognized as a member of the SDR16C family of enzymes . The UniProt ID for bovine DHRS3 is O77769, providing a standardized reference for this protein in biological databases . Unlike many other SDR family members that prefer NADP as a cofactor, DHRS3 has a unique preference for the phosphorylated NAD cofactor, which influences its function as a reductase in intact cells .

Genetic Information

The DHRS3 gene in bovine species encodes for the DHRS3 protein. While the search results don't specify the exact chromosomal location of bovine DHRS3, comparative genomics indicates conservation across mammalian species . The protein shares structural similarities with DHRS3 proteins from other species, including humans, mice, and other mammals, indicating evolutionary conservation of this important enzyme .

Catalytic Function

DHRS3 functions primarily as a retinaldehyde reductase, catalyzing the conversion of all-trans-retinaldehyde back to retinol (vitamin A) . This reaction represents a critical regulatory step in the metabolism of vitamin A, as it controls the availability of retinaldehyde for oxidation to retinoic acid . By reducing retinaldehyde levels, DHRS3 effectively limits the production of retinoic acid, providing a mechanism to prevent excessive retinoic acid formation during embryonic development .

Enzymatic Pathway and Interactions

Within the retinoid metabolic pathway, DHRS3 acts in opposition to retinol dehydrogenase 10 (RDH10), which catalyzes the oxidation of retinol to retinaldehyde . This opposing action creates a regulatory mechanism that helps maintain appropriate levels of retinaldehyde, the precursor to retinoic acid . Recent studies have shown that DHRS3 and RDH10 can form a protein complex in which DHRS3 becomes enzymatically active, leading to increased conversion of retinaldehyde to retinol . This interaction appears to be specific to RDH10 and DHRS3, as other related enzymes do not show this mutually activating interaction .

Role in Development

Studies on DHRS3-deficient animal models have demonstrated the crucial role of this enzyme in embryonic development . Mice lacking DHRS3 show a 40% increase in retinoic acid levels and 60% and 55% decreases in retinol and retinyl esters, respectively, compared to wild-type littermates . These alterations in retinoid metabolism lead to various developmental defects, including abnormalities in cardiac outflow tract formation, skeletal development, and palatogenesis . Similar developmental defects have been observed in other model organisms with disrupted DHRS3 function, highlighting the evolutionary conservation of DHRS3's role in development .

Tissue Expression Patterns

While bovine-specific expression data is limited in the search results, studies in other species indicate that DHRS3 is expressed in multiple embryonic and adult tissues . Expression patterns are dynamically regulated during development, with specific expression in tissues where retinoic acid signaling plays important roles .

Regulation of Expression

DHRS3 expression is regulated by multiple factors, with retinoic acid itself being a key regulator . This creates a negative feedback loop where increased retinoic acid levels induce DHRS3 expression, which then reduces retinaldehyde availability for retinoic acid synthesis . This feedback mechanism is crucial for maintaining retinoic acid homeostasis during development .

In addition to retinoic acid, other factors that regulate DHRS3 expression include vitamin A status, with DHRS3 expression being sensitive to dietary changes in vitamin A levels . This nutritional regulation further contributes to the maintenance of appropriate retinoid metabolism under varying conditions .

Production Methods

Recombinant bovine DHRS3 is typically produced using bacterial (E. coli) or mammalian expression systems . The production process involves cloning the bovine DHRS3 gene or a portion of it into an appropriate expression vector, transforming the host cells, inducing protein expression, and purifying the resulting protein . The recombinant protein may be produced with various tags (such as His-tag) to facilitate purification and detection .

Basic Research Applications

Recombinant bovine DHRS3 serves as a valuable tool in basic research focused on retinoid metabolism and developmental biology . It provides a means to study the enzymatic properties of DHRS3 in controlled in vitro settings, offering insights into its catalytic mechanisms and substrate specificity . Additionally, recombinant DHRS3 can be used in protein-protein interaction studies to investigate its associations with other enzymes involved in retinoid metabolism, such as RDH10 .

Comparative Studies

The availability of recombinant DHRS3 from multiple species, including bovine, enables comparative studies to explore evolutionary conservation and species-specific differences in retinoid metabolism . These comparative analyses contribute to our understanding of the fundamental mechanisms of vitamin A metabolism across different taxonomic groups .

Drug Discovery and Development

Recombinant bovine DHRS3 can serve as a target for drug discovery efforts aimed at modulating retinoid metabolism . Given the importance of retinoic acid signaling in various biological processes, including development, immune function, and cancer, compounds that modulate DHRS3 activity could have therapeutic potential . In particular, the recent finding that DHRS3 regulates melanoma cell differentiation suggests potential applications in cancer research .

Evolutionary Conservation

Phylogenetic analyses have shown that DHRS3 represents an evolutionarily ancient enzyme, with homologs found in invertebrate chordates, non-chordate deuterostomes, and protostomes . This broad distribution suggests that the common ancestor of protostome and deuterostome animals (Urbilaterian) possessed a DHRS3-similar enzyme . The bovine DHRS3, like its counterparts in other vertebrates, shares key structural features that distinguish DHRS3 from other SDR family members .

Functional Conservation

Despite some species-specific differences, the fundamental function of DHRS3 in regulating retinoid metabolism appears to be conserved across species . Studies in various model organisms, including mice, zebrafish, and Xenopus, have consistently demonstrated the critical role of DHRS3 in preventing excessive retinoic acid formation during embryonic development .

Species-Specific Variations

While the core function of DHRS3 is conserved, species-specific variations in regulation, expression patterns, and protein-protein interactions may exist . These variations could reflect adaptations to different developmental programs or environmental conditions . Investigating these species-specific differences using recombinant proteins from various species, including bovine, can provide insights into the evolutionary adaptations of retinoid metabolism .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
DHRS3; Short-chain dehydrogenase/reductase 3; Retinal short-chain dehydrogenase/reductase 1; retSDR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
DHRS3
Target Protein Sequence
MVWKRLGALVVFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAE RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITIL VNNAAVVHGKSLMDSDDDALPKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALS AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP LKPETVARRTVEAVQLNQALLLLPWTMHALIILKSILPQAALEEIHKFSGTYTCINTFKG RT
Uniprot No.

Target Background

Function
Catalyzes the reduction of all-trans-retinal to all-trans-retinol in the presence of NADPH.
Database Links

KEGG: bta:281482

STRING: 9913.ENSBTAP00000033930

UniGene: Bt.5530

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
In the retina, expressed in cone but not rod outer segments.

Q&A

Basic Research Questions

  • What is the primary enzymatic function of DHRS3 in retinoid metabolism?

DHRS3 functions as a retinaldehyde-specific reductase that converts retinaldehyde (retinal) back to retinol (vitamin A), effectively decreasing the rate of retinoic acid biosynthesis . This enzymatic activity is critical for maintaining proper retinoic acid levels during development, as demonstrated by studies showing that DHRS3 is essential for preventing formation of excess all-trans-retinoic acid (ATRA) during embryonic development .

Methodologically, researchers can assess DHRS3 function by measuring changes in retinol, retinaldehyde, and retinoic acid levels using HPLC analysis after experimental manipulation of DHRS3 expression. DHRS3-null embryos exhibit approximately 4-fold lower levels of retinol and retinyl esters compared to wild-type, with membrane-associated retinaldehyde reductase activities decreased by approximately 4-fold .

  • What expression vectors are recommended for producing recombinant DHRS3?

For successful expression of recombinant DHRS3, several vector systems have been validated in the literature:

For constitutive expression:

  • pIRES2 DsRed-Express2 vector has been successfully used for DHRS3 expression in neuroblastoma cell lines

  • pCMV-Tag4a vector with C-terminal FLAG tag has been employed for detection and purification purposes

  • pIRESneo vector has been utilized for untagged DHRS3 expression

For inducible expression:

  • The Retro-X Tet-On Advanced System provides temporal control over DHRS3 expression, which is particularly useful as prolonged high-level expression can lead to cellular senescence and death in some cell lines

When designing expression constructs, researchers should consider:

  • N-terminal 3xFLAG tags have been successfully used without compromising DHRS3 function

  • PCR amplification using primers that incorporate appropriate restriction sites (such as EcoRI, SalI, or BamHI) facilitates directional cloning into expression vectors

  • What phenotypes are observed when DHRS3 expression is altered in model systems?

Alteration of DHRS3 expression produces distinct developmental phenotypes that reflect its crucial role in retinoid metabolism:

DHRS3 knockout/knockdown effects:

  • In mouse models, homozygous DHRS3 deletion leads to embryonic lethality, demonstrating its essential role in development

  • In Xenopus, DHRS3 morphants exhibit significant reduction in head diameter

  • Expression of neuroectoderm marker genes (en2, krox2, and hoxb3) is abolished or suppressed on the injected side in DHRS3 morphants

  • Disruption of the brachyury expression ring at the dorsal blastopore lip and reduction in the migration distance of goosecoid is observed

  • Increased concentration of all-trans-retinoic acid is measured in DHRS3 morphants

DHRS3 overexpression effects:

  • In neuroblastoma cell lines, DHRS3 overexpression leads to morphological changes resembling cellular senescence, including enlargement and flattening of cells

  • Accumulation of lipid droplets is observed, particularly in NH12 and SK-N-SH neuroblastoma cell lines

  • Cell growth rate is suppressed in SK-N-SH and NH12 cell lines with DHRS3 induction

  • Cell death occurs when DHRS3 is expressed at high levels for more than 6 days

These phenotypes provide valuable readouts for validating recombinant DHRS3 activity in experimental systems.

  • Where is recombinant DHRS3 protein localized within cells?

Recombinant DHRS3 exhibits specific subcellular localization patterns that are important for its function:

  • When expressed in neuroblastoma cell lines, DHRS3 is primarily localized to the plasma membrane, endoplasmic reticulum (ER), and nucleus

  • In NH12 and SK-N-SH cells, DHRS3 expression leads to an accumulation of lipid droplets (LDs)

  • Shortly after transfection, DHRS3 is distributed throughout the cytoplasm, but after prolonged expression (>5 days), it translocates specifically to the membrane surface of lipid droplets

  • Electron microscopy confirms the presence of small vesicles containing DHRS3 in the cytoplasm, consistent with lipid droplet association

For visualizing recombinant DHRS3:

  • Immunofluorescence using anti-DHRS3 antibodies (such as anti-DHRS3, 15393-1AP from ProteinTech) at 1:200 dilution has been validated

  • Tagged versions with FLAG epitopes facilitate detection using commercially available anti-FLAG antibodies

  • Co-staining with lipid-specific dyes such as Lipid Tox helps confirm association with lipid droplets

  • How is DHRS3 expression regulated in response to retinoic acid?

DHRS3 participates in a feedback regulatory loop with retinoic acid signaling:

  • DHRS3 expression is upregulated by all-trans-retinoic acid (atRA) exposure, as demonstrated in animal cap assays where exogenous atRA elevated DHRS3 expression

  • In situ hybridization shows that DHRS3 expression domains are intensified and expanded, covering almost the entire neural plate after atRA treatment

  • This upregulation creates a negative feedback loop: increased retinoic acid induces DHRS3 expression, which then reduces retinaldehyde availability for retinoic acid synthesis

  • Similar expansion patterns are observed with other retinoic acid-responsive genes like cyp26a1

For experimental purposes, this regulatory relationship means:

  • Recombinant DHRS3 expression systems may be influenced by endogenous retinoic acid levels in the host cells

  • Pre-treatment with retinoic acid can be used to boost expression of recombinant DHRS3 driven by its native promoter

  • Analysis of DHRS3 function should account for this feedback regulation when interpreting results

Advanced Research Questions

  • What experimental approaches can measure enzymatic activity of recombinant DHRS3?

Measuring the enzymatic activity of recombinant DHRS3 requires specialized approaches that account for its unique properties:

Assay TypeMethodologyKey ConsiderationsDetection Method
Direct enzyme assaysIncubation of purified recombinant DHRS3 with all-trans-retinaldehyde and NADPH cofactorRequires protection from light; oxygen-free conditions recommendedHPLC with UV detection for retinol formation
Coupled enzyme systemsCo-expression of DHRS3 with RDH10 to account for their reciprocal activationMore physiologically relevant; mimics in vivo conditionsLC-MS/MS for sensitive detection of retinoid metabolites
Cell-based activity assaysMeasurement of retinoid profiles in cells expressing recombinant DHRS3Accounts for cellular context but includes contribution of endogenous enzymesHPLC or LC-MS/MS analysis of cell extracts
Competitive substrate assaysMeasurement of DHRS3 activity in competition with ALDH1A2 for retinaldehydeMimics the competition occurring in vivoSimultaneous measurement of retinol and retinoic acid formation

Important methodological considerations:

  • DHRS3 shows optimal activity when co-expressed with RDH10, as they reciprocally activate each other

  • Membrane-associated fractions should be isolated for maximum activity, as DHRS3 is primarily membrane-bound

  • NADPH must be supplied as the essential cofactor for the reduction reaction

  • Activity is significantly reduced in DHRS3-null embryos, with membrane-associated retinaldehyde reductase activities decreased by approximately 4-fold

  • How does the reciprocal relationship between DHRS3 and RDH10 impact experimental design with recombinant proteins?

The discovery that DHRS3 and RDH10 reciprocally activate each other has profound implications for experimental design:

  • DHRS3 requires RDH10 for full enzymatic activity as a retinaldehyde reductase

  • In turn, DHRS3 activates the retinol dehydrogenase activity of RDH10

  • This mutually activating relationship allows for precise control over retinoic acid biosynthesis

Experimental recommendations based on this relationship:

Experimental ConditionExpected OutcomeExperimental Consideration
DHRS3 expressed aloneSuboptimal retinaldehyde reductase activityMay underestimate true enzymatic potential
DHRS3 co-expressed with RDH10Enhanced retinaldehyde reductase activityMore accurately reflects physiological activity
DHRS3 knockout/knockdownDecreased retinaldehyde reductase activity and decreased retinol dehydrogenase activityPhenotypes reflect both direct and indirect effects
Reconstitution experimentsRestoration of both enzymatic activitiesRequires careful titration of both proteins

Researchers should:

  • Design co-expression systems for recombinant DHRS3 and RDH10 when studying enzymatic activity

  • Consider protein-protein interaction studies (co-immunoprecipitation, proximity ligation assays) to investigate the mechanism of mutual activation

  • Account for the reciprocal relationship when interpreting phenotypes in knockout/knockdown models

  • What are the optimal conditions for expressing recombinant DHRS3 in mammalian cell systems?

Successful expression of recombinant DHRS3 in mammalian cells requires optimization of several parameters:

Expression SystemCell LinesVectorInduction/Expression TimeSpecial Considerations
ConstitutiveSK-N-SH, NH12, TGW neuroblastomapIRES2 DsRed-Express2, pCMV-Tag4a3-5 days for optimal expressionCell morphology changes observed after expression
InducibleSK-N-SH, NH12Retro-X Tet-On AdvancedExpression begins 6h post-induction; optimal at 3-5 daysProlonged expression (>6 days) leads to cell death
TransientHEK293, COS-7pCMV-based vectors24-72h post-transfectionHigher expression but shorter duration

Protein detection and validation methods:

  • Western blotting using anti-DHRS3 antibodies (15393-1AP, ProteinTech) at 1:200 dilution

  • Fluorescent immunostaining for subcellular localization

  • For tagged constructs, anti-FLAG M2 antibodies effectively detect exogenous DHRS3

Important considerations:

  • DHRS3 expression leads to accumulation of lipid droplets, especially in NH12 and SK-N-SH cells

  • Cellular morphology changes resembling senescence (enlargement and flattening) occur following expression

  • Cell migration is reduced in DHRS3-expressing cells, as demonstrated by gap-closure assays

  • Co-expression with RDH10 enhances enzymatic activity and may be necessary for functional studies

  • How can gene-expression analysis be used to validate recombinant DHRS3 activity?

Gene expression analysis provides valuable insights into the functional activity of recombinant DHRS3:

Research has shown that DHRS3 overexpression significantly alters the expression of numerous genes:

  • In SK-N-SH cells with DHRS3 overexpression, 23 genes were more than 10-fold upregulated and 211 genes were more than 10-fold downregulated

  • Key upregulated genes include ELFN1, TAC3, SMOC1, and NME1-NME2

  • Significant downregulation was observed in genes involved in cell differentiation and cell adhesion, including LIF, CD44, COL3A1, COL5A1, THBS1, and THBS2

Methodological approaches for validating recombinant DHRS3 activity through gene expression analysis:

TechniqueApplicationAdvantagesKey Markers
RNA sequencingGenome-wide expression profilingComprehensive, quantitative, discovers novel transcriptsCompare to established DHRS3 expression signatures
qRT-PCRTargeted gene expression analysisHigh sensitivity, good for validating specific markersDHRS3, CYP26A1, NROB1, retinoid metabolism genes
MicroarrayMedium-throughput gene expressionWell-established technology, cost-effectivePattern matching with known DHRS3 response genes
In situ hybridizationSpatial expression analysisMaps expression in tissues/embryosneuroectoderm markers (en2, krox2, hoxb3)
Reporter assaysFunctional readout of signalingDirect measure of pathway activityRetinoic acid response elements (RARE) reporters

When validating recombinant DHRS3 activity:

  • Compare expression profiles to established signatures from DHRS3 overexpression studies

  • Focus on known retinoic acid-responsive genes as indicators of altered retinoid metabolism

  • Use pathway analysis tools (GeneMANIA, IPA, Strand STS) to identify affected biological processes

  • What methodological approaches can detect interactions between recombinant DHRS3 and other proteins?

Understanding DHRS3 interactions with other proteins, particularly RDH10, is crucial for comprehending its function:

TechniqueApplicationResolutionKey Considerations
Co-immunoprecipitationPhysical interaction detectionProtein complex levelRequires antibodies or epitope tags; may disrupt weak interactions
Proximity ligation assayIn situ protein interactionSubcellular localizationVisualizes interactions in their native cellular context
FRET/BRETReal-time interaction dynamicsNanometer resolutionRequires fluorescent/bioluminescent tagging; can detect transient interactions
Split-protein complementationDirect interaction validationBinary readoutGood for confirming specific interactions; may stabilize transient interactions
Crosslinking mass spectrometryInteraction interface mappingAmino acid resolutionIdentifies specific residues involved in interactions

When studying DHRS3 interactions:

  • The DHRS3-RDH10 interaction is of particular importance due to their reciprocal activation

  • Membrane localization of DHRS3 may require specialized approaches for solubilization while preserving interactions

  • Lipid droplet association may mediate certain protein-protein interactions

  • Changes in protein localization after expression (such as movement to lipid droplets) should be monitored, as this may affect interaction partners

Consider that:

  • DHRS3 and RDH10 interactions are likely critical for the precise control of retinoic acid biosynthesis

  • The molecular mechanism of their mutual activation remains to be fully characterized

  • Protein-protein interactions may be influenced by retinoid concentrations, creating feedback regulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.