Recombinant Bovine Short-chain dehydrogenase/reductase family 42E member 1 (SDR42E1)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bovine Short-chain dehydrogenase/reductase family 42E member 1 (SDR42E1) is a protein that belongs to the short-chain dehydrogenases/reductases (SDR) superfamily. SDR42E1 is found in Bos taurus (Bovine) . The enzyme commission number for this protein is EC= 1.1.1.- . In humans, the SDR42E1 gene is located on chromosome 1 .

Basic Information

PropertyValue
Product CodeCSB-BP654169BO1
AbbreviationSDR42E1
Uniprot No.Q32L94
Product TypeRecombinant Protein
Immunogen SpeciesBos taurus (Bovine)
Purity>85% (SDS-PAGE)
SourceBaculovirus
Target NamesSDR42E1
Protein NamesRecommended name: Short-chain dehydrogenase/reductase family 42E member 1 EC= 1.1.1.-
Protein LengthPartial
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C
StorageLiquid form: 6 months at -20°C/-80°C; Lyophilized form: 12 months at -20°C/-80°C. Repeated freezing and thawing is not recommended; store working aliquots at 4°C for up to one week

Function and Characteristics

SDRs are one of the oldest and most heterogeneous protein superfamilies . These proteins may have identities as low as 4%, with homology inferred from similar 3D structure and function . SDR42E1 contains a short chain dehydrogenase domain and belongs to the SDR family .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
SDR42E1; Short-chain dehydrogenase/reductase family 42E member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SDR42E1
Target Protein Sequence
MDSHKSPKETVLITGGGGYFGFRLGCALNLLGVHVILFDISHPAQTIPEGIRFILGDIRC LSDIENAFQGVDVACVFHIASYGMSGREQLNRSLIEEINVGGTDNILQACRRRGVPRLVY TSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEKKVLSANGTALERGGGVLST CALRPAGIYGPGEQRHLPRIVSYIEKGLFRFVYGDPKSLVEFVHVDNLVQAHILASEALK ANKGHIAAGQPYFISDGRPVNNFEFFRPLVEGLGYKFPSTRLPLTLIYCFAFLTEMTHFI LGRLYNFQPFLTRTEVYKTGVTHYFSLEKARKELGYEAQPFDLQEAVEWFKAHGHGRRPG SCDSKCLVWDGLVILLVVTVVLVWLLPSVILSM
Uniprot No.

Target Background

Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SDR42E1 and what is its biological significance?

SDR42E1 is a member of the extended short-chain dehydrogenase/reductase superfamily with broad substrate specificity and potential involvement in lipid metabolism. While its precise function has been uncertain, recent research has elucidated its crucial role in steroid synthesis. The protein functions as an oxidoreductase and steroid delta-isomerase, potentially utilizing nicotinamide adenine dinucleotide phosphate (NAD(P)(H)) .

Recent functional characterization reveals SDR42E1's pivotal role in vitamin D homeostasis, particularly in the biosynthesis pathway. The protein demonstrates pronounced expression in skin keratinocytes, which are key sites of vitamin D production in the body . Genetic studies have highlighted a close interrelation between SDR42E1 and the regulation of steroid hormone biosynthesis, making it a significant target for research into vitamin D deficiency mechanisms .

How does SDR42E1 function in vitamin D biosynthesis?

SDR42E1 plays a critical role in vitamin D biosynthesis through its involvement in steroid metabolism pathways. Research employing CRISPR/Cas9 gene-editing technology and multi-omics approaches has demonstrated that depleting SDR42E1 results in a 1.6-fold disruption in the steroid biosynthesis pathway (P-value = 0.03) .

This disruption significantly affects crucial vitamin D biosynthesis regulators. Notable changes include upregulation of SERPINB2 (P-value = 2.17 × 10^-103), EBP (P-value = 2.46 × 10^-13), and DHCR7 (P-value = 8.03 × 10^-09) by approximately 2-3 fold, while ALPP (P-value <2.2 × 10^-308), SLC7A5 (P-value = 1.96 × 10^-215), and CYP26A1 (P-value = 1.06 × 10^-08) are downregulated by approximately 1.5-3 fold .

These molecular alterations result in the accumulation of 7-dehydrocholesterol (7-DHC) precursor and reduction of vitamin D3 production, as confirmed by drug enrichment analysis (P-value = 4.39 × 10^-06) and total vitamin D quantification (R² = 0.935, P-value = 0.0016) .

What are the recommended methods for generating SDR42E1-knockout models?

Based on current research, CRISPR/Cas9 gene-editing technology has been successfully employed to create SDR42E1-knockout models. The protocol involves:

  • Selection of an appropriate cell line: HaCaT human keratinocyte cell lines have been effectively used due to their pronounced expression of SDR42E1, mimicking the expression patterns observed in skin keratinocytes .

  • CRISPR/Cas9-sgRNA construct design: Target-specific single guide RNAs (sgRNAs) should be designed to target the SDR42E1 gene .

  • Viral transduction: Target cells should be infected with viruses generated from each CRISPR/Cas9-sgRNA construct at a multiplicity of infection (MOI) of 5, with the addition of polybrene (10 μg/mL) to enhance transduction efficiency .

  • Selection of successfully edited cells: After 24 hours of transduction at 37°C, apply puromycin (2–5 μg/mL) for approximately 7 days to eliminate non-transduced cells .

  • Harvest cells at 80% confluency for subsequent DNA analysis and validation of knockout efficiency .

This methodology allows researchers to mimic genetic variants, such as the rs11542462 nonsense variant, which introduces a premature stop codon resulting in the substitution of glutamine with termination at position 30 of the protein (p.Q30* GLN>*TER) .

What multi-omics approaches are most effective for studying SDR42E1 function?

An integrated multi-omics approach combining transcriptomics and proteomics has proven effective for comprehensive profiling of SDR42E1 functions. Key components of this approach include:

  • Transcriptomics analysis: Perform bulk RNA sequencing on SDR42E1 knockout cell lines alongside wild-type controls. This approach has successfully identified global transcriptomic changes associated with SDR42E1 depletion, particularly in pathways related to lipid and steroid biosynthesis .

  • Proteomics analysis: Complement transcriptomic data with proteomics to validate gene expression changes at the protein level and identify post-transcriptional regulatory mechanisms .

  • Pathway analysis: Employ pathway enrichment analysis to identify biological processes affected by SDR42E1 depletion. This approach has revealed significant disruptions in steroid biosynthesis pathways (1.6-fold, P = 0.03) .

  • Drug enrichment analysis: This method has been successful in identifying the accumulation of 7-dehydrocholesterol precursor and reduction of vitamin D3 production (P-value = 4.39 × 10^-06) .

  • Vitamin D quantification: Direct measurement of vitamin D levels using appropriate assays provides quantitative validation of the functional impact of SDR42E1 depletion (R² = 0.935, P-value = 0.0016) .

This multi-omics approach provides a comprehensive understanding of SDR42E1's biological functions and its impact on vitamin D homeostasis.

What protein expression and purification methods are recommended for recombinant bovine SDR42E1?

While the search results do not provide specific details on expression and purification methods for recombinant bovine SDR42E1, general recommendations based on the available information include:

  • Expression systems: Recombinant protein expression systems compatible with the full-length protein (amino acids 1-393) should be selected. The specific expression system should be optimized based on the research requirements .

  • Purification considerations: The recombinant protein may include a tag for purification purposes, though the specific tag type would be determined during the production process to optimize for protein stability and activity .

  • Storage conditions: Once purified, the recombinant protein should be stored in a Tris-based buffer with 50% glycerol, optimized for this specific protein. For short-term storage, the protein can be kept at -20°C, while for extended storage, conservation at -20°C or -80°C is recommended .

  • Handling recommendations: Repeated freezing and thawing should be avoided. Working aliquots can be stored at 4°C for up to one week to maintain protein integrity .

How do genetic variants in SDR42E1 impact vitamin D metabolism?

Genetic variants in SDR42E1 have significant implications for vitamin D metabolism, as evidenced by several research findings:

  • Nonsense variant rs11542462: This variant in exon 3 of SDR42E1 introduces a premature stop codon, resulting in the substitution of glutamine with termination at position 30 of the protein (p.Q30* GLN>*TER). This mutation potentially leads to a non-functional SDR42E1 enzyme, affecting its role in vitamin D biosynthesis .

  • Association with vitamin D precursors: The nonsense variant in SDR42E1 has been associated with serum concentrations of the vitamin D precursor 8-DHC, which demonstrates a close relationship with 7-DHC, a crucial precursor in vitamin D synthesis .

  • Cross-ancestry genetic studies: Cross-ancestry analyses have identified genetic loci associated with 25-hydroxyvitamin D (25OHD) levels, revealing the impact of different genetic variants across diverse populations. While specific SDR42E1 variants were not detailed in the cross-ancestry studies, the research highlights the importance of genetic determinants in vitamin D homeostasis .

  • Experimental validation: Functional studies using CRISPR/Cas9-mediated SDR42E1 knockout models have confirmed that depletion of SDR42E1 disrupts steroid biosynthesis pathways and affects key vitamin D biosynthesis regulators, leading to accumulation of 7-DHC precursor and reduction of vitamin D3 production .

These findings underscore the importance of SDR42E1 in vitamin D metabolism and suggest that genetic variants in this gene could contribute to individual differences in vitamin D status and related health outcomes.

What is the relationship between SDR42E1 and other genes involved in vitamin D metabolism?

SDR42E1 interacts with several key genes involved in vitamin D metabolism, as revealed by transcriptomic and proteomic analyses:

  • DHCR7 (7-dehydrocholesterol reductase): SDR42E1 depletion leads to significant upregulation of DHCR7 (P-value = 8.03 × 10^-09) by approximately 2-3 fold. DHCR7 catalyzes the conversion of 7-DHC to cholesterol, competing with the vitamin D synthesis pathway where 7-DHC is converted to vitamin D3 upon UV exposure .

  • CYP26A1: SDR42E1 knockout results in downregulation of CYP26A1 (P-value = 1.06 × 10^-08) by approximately 1.5-3 fold. CYP26A1 is involved in the metabolism of retinoic acid, which can interact with vitamin D signaling pathways .

  • EBP (emopamil binding protein): SDR42E1 depletion causes upregulation of EBP (P-value = 2.46 × 10^-13) by approximately 2-3 fold. EBP is involved in cholesterol biosynthesis, which intersects with vitamin D metabolism .

  • SERPINB2, ALPP, and SLC7A5: These genes also show significant expression changes following SDR42E1 knockout, suggesting broader regulatory networks connecting SDR42E1 to vitamin D metabolism. Specifically, SERPINB2 is upregulated (P-value = 2.17 × 10^-103), while ALPP (P-value <2.2 × 10^-308) and SLC7A5 (P-value = 1.96 × 10^-215) are downregulated .

  • Potential interaction with CYP2R1: While not directly mentioned in the SDR42E1 functional characterization, cross-ancestry analyses identified variants near CYP2R1, a key enzyme in vitamin D metabolism, suggesting potential functional interplay between these genes in the vitamin D pathway .

These findings illustrate the complex regulatory network involving SDR42E1 and other genes in vitamin D metabolism, highlighting the importance of systems biology approaches in understanding vitamin D homeostasis.

How can SDR42E1 research contribute to addressing vitamin D deficiency?

SDR42E1 research offers significant potential for addressing vitamin D deficiency through several avenues:

  • Precision medicine approaches: Understanding the role of SDR42E1 and its genetic variants can facilitate personalized approaches to vitamin D supplementation. Individuals with specific SDR42E1 variants may require tailored intervention strategies to optimize their vitamin D status .

  • Drug target identification: The elucidation of SDR42E1's function in vitamin D biosynthesis provides a potential new drug target for addressing vitamin D deficiency. Compounds that modulate SDR42E1 activity could potentially enhance vitamin D production or metabolism .

  • Biomarker development: SDR42E1 genetic variants or protein levels could serve as biomarkers for predicting vitamin D deficiency risk or response to supplementation, allowing for more targeted preventive measures .

  • Understanding population differences: Cross-ancestry genetic studies involving SDR42E1 and other vitamin D-related genes can help explain population differences in vitamin D status and response to environmental factors, informing public health strategies for diverse populations .

  • Diagnostic tool development: Knowledge of SDR42E1's role in vitamin D metabolism could lead to improved diagnostic tools for assessing vitamin D status and identifying underlying causes of deficiency beyond simple measurement of 25(OH)D levels .

Research into SDR42E1 thus represents a promising avenue for advancing our understanding of vitamin D homeostasis and developing more effective strategies to address the global health challenge of vitamin D deficiency.

What are common challenges in working with recombinant SDR42E1 and how can they be addressed?

While the search results do not provide specific challenges related to working with recombinant SDR42E1, general considerations for this type of protein include:

  • Protein stability: Short-chain dehydrogenase/reductase family proteins like SDR42E1 may face stability issues during expression and purification. Using appropriate storage buffers (such as Tris-based buffer with 50% glycerol) and avoiding repeated freeze-thaw cycles can help maintain protein integrity .

  • Enzymatic activity preservation: As SDR42E1 functions as an oxidoreductase and steroid delta-isomerase utilizing NAD(P)(H), ensuring the preservation of its enzymatic activity during purification and storage is crucial. Optimizing buffer conditions and including cofactors may help maintain activity .

  • Expression system selection: Choosing an appropriate expression system that properly folds and post-translationally modifies the protein is essential. The tag type should be carefully determined during the production process to optimize for protein functionality .

  • Substrate identification: Given SDR42E1's broad substrate specificity, identifying and validating its specific substrates can be challenging. Multi-omics approaches and biochemical assays targeting proposed substrates (such as vitamin D3, 8-DHC, 7-DHC, and 25(OH)D) can help address this challenge .

How can researchers validate the specificity and functionality of SDR42E1 in experimental models?

To validate the specificity and functionality of SDR42E1 in experimental models, researchers can employ several complementary approaches:

These validation approaches ensure robust and reproducible findings regarding SDR42E1's function and specificity in experimental models.

What analytical methods are recommended for studying SDR42E1's impact on vitamin D metabolism?

Based on the research findings, several analytical methods are recommended for studying SDR42E1's impact on vitamin D metabolism:

  • RNA sequencing: Bulk RNA sequencing has been successfully employed to identify global transcriptomic changes associated with SDR42E1 knockout, revealing significant alterations in genes involved in steroid biosynthesis and vitamin D metabolism .

  • Proteomics analysis: Mass spectrometry-based proteomics complements transcriptomic data by confirming changes at the protein level and identifying post-translational modifications that may affect enzyme activity .

  • Metabolite profiling: Analytical techniques such as liquid chromatography-mass spectrometry (LC-MS) can be used to measure changes in vitamin D metabolites (including precursors like 7-DHC and 8-DHC) following SDR42E1 manipulation .

  • Vitamin D quantification assays: Direct measurement of total vitamin D levels using appropriate assays provides quantitative validation of SDR42E1's impact on vitamin D biosynthesis (R² = 0.935, P-value = 0.0016) .

  • Pathway enrichment analysis: Computational analysis of transcriptomic and proteomic data can identify significantly altered biological pathways, such as the observed 1.6-fold disruption in steroid biosynthesis pathway (P-value = 0.03) .

  • Drug enrichment analysis: This computational approach has been successful in identifying the accumulation of 7-dehydrocholesterol precursor and reduction of vitamin D3 production (P-value = 4.39 × 10^-06) .

These analytical methods, used in combination, provide a comprehensive understanding of SDR42E1's impact on vitamin D metabolism at the molecular, cellular, and biochemical levels.

What are the most promising areas for future SDR42E1 research?

Several promising areas for future SDR42E1 research emerge from the current findings:

  • Structural biology: Detailed structural characterization of SDR42E1 would enhance our understanding of its catalytic mechanism and substrate binding, potentially enabling structure-based drug design for modulating its activity .

  • Population genetics: Expanding cross-ancestry studies to identify additional SDR42E1 genetic variants and their prevalence in different populations could provide insights into the genetic basis of vitamin D deficiency across diverse ethnic groups .

  • Clinical studies: Investigating the association between SDR42E1 variants and clinical outcomes related to vitamin D deficiency (such as bone health, immune function, and metabolic disorders) would establish the clinical relevance of SDR42E1 research .

  • Drug discovery: Screening for compounds that modulate SDR42E1 activity could lead to novel therapeutic approaches for addressing vitamin D deficiency, particularly in individuals with genetic predispositions .

  • Systems biology: Further exploration of the regulatory networks connecting SDR42E1 to other genes involved in vitamin D metabolism would provide a more comprehensive understanding of vitamin D homeostasis .

  • Animal models: Developing and characterizing SDR42E1 knockout animal models would allow for investigation of its function in complex physiological systems and across different tissues .

These research directions hold significant potential for advancing our understanding of SDR42E1's role in vitamin D metabolism and leveraging this knowledge to address vitamin D deficiency.

How might advances in SDR42E1 research impact personalized medicine approaches to vitamin D deficiency?

Advances in SDR42E1 research have several potential impacts on personalized medicine approaches to vitamin D deficiency:

  • Genetic screening: Identification and validation of functionally significant SDR42E1 variants, such as rs11542462, could inform genetic screening protocols to identify individuals at higher risk of vitamin D deficiency due to genetic factors .

  • Tailored supplementation: Understanding how SDR42E1 variants affect vitamin D metabolism could enable personalized vitamin D supplementation regimens, with dosages and formulations tailored to an individual's genetic profile .

  • Alternative intervention strategies: For individuals with SDR42E1 variants that impair vitamin D biosynthesis, alternative intervention strategies targeting downstream pathways might be more effective than standard supplementation approaches .

  • Biomarker development: SDR42E1 variants or protein levels could serve as biomarkers for predicting response to vitamin D supplementation, allowing for more targeted and effective intervention strategies .

  • Drug development: Knowledge of SDR42E1's role in vitamin D metabolism could lead to the development of novel therapeutics that specifically address genetic causes of vitamin D deficiency by modulating SDR42E1 activity or bypassing impaired pathways .

These personalized medicine approaches represent a significant advancement over current one-size-fits-all strategies for addressing vitamin D deficiency and hold promise for improving health outcomes related to vitamin D status.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.