Recombinant Bovine Short transient receptor potential channel 5 (TRPC5)

What is the functional significance of TRPC5 in cellular calcium signaling?

TRPC5 plays a crucial role in store-operated calcium entry (SOCE) pathways. Research demonstrates that TRPC5 permits optimal influx of Ca²⁺ and Sr²⁺ in cells following calcium store depletion. Importantly, TRPC5 functions in conjunction with Orai1 and STIM1 proteins to facilitate this process. Experimental studies using knockdown approaches have shown that TRPC5 is essential for thapsigargin-induced entry of both Ca²⁺ and Sr²⁺, with the latter being particularly dependent on TRPC5 . This channel's activity is primarily regulated by store depletion rather than through PLC/diacylglycerol-dependent mechanisms, as demonstrated by experiments showing that diacylglycerol analogs fail to activate TRPC5-mediated cation entry .

How does the amino acid sequence of bovine TRPC5 compare to human TRPC5?

The commercially available recombinant bovine TRPC5 protein (amino acids 1-109) has the sequence: FIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQL . This N-terminal region contains important structural elements for channel assembly and regulation. When comparing bovine and human TRPC5 sequences, researchers should note conservation in key functional domains while recognizing species-specific variations that may affect experimental interpretations. Alignment analysis of these sequences reveals conservation in transmembrane domains and pore regions, with some variation in regulatory domains, which may influence experimental design when translating findings between species.

How do TRPC5, STIM1, and Orai1 interact to regulate store-operated calcium entry?

The interaction between TRPC5, STIM1, and Orai1 represents a complex regulatory mechanism for calcium entry. Research demonstrates that knockdown of either STIM1 or Orai1 significantly suppresses thapsigargin-induced Sr²⁺ and Ca²⁺ entry, similar to TRPC5 knockdown . Experimental findings reveal distinctive roles for these proteins:

• STIM1 serves as the essential sensor for calcium store depletion

• Orai1 is required for both Sr²⁺ and Ca²⁺ entry

• TRPC5 is necessary for optimal cation influx

Overexpression experiments show that:

• Orai1+STIM1 overexpression allows only Ca²⁺ influx

• TRPC5+STIM1 overexpression permits both Sr²⁺ and Ca²⁺ influx

• Overexpression of Orai1 or TRPC5 alone suppresses cation entry

These findings suggest that stoichiometric interactions between these proteins are critical for proper channel function, and that TRPC5 likely forms a functional complex with Orai1 and STIM1 rather than operating as an independent channel.

What are the neuronal mechanisms through which TRPC5 regulates obesity and postpartum depression?

TRPC5 exerts its effects on obesity and postpartum depression through distinct neuronal populations in the hypothalamus. Research has identified at least two key mechanisms:

• Pomc Neuron Pathway: Approximately 90% of Pomc neurons in the arcuate nucleus of the hypothalamus express TRPC5. These neurons help regulate body weight by reducing food intake. Genetic disruption of TRPC5 impairs the ability of Pomc neurons to reduce appetite in experimental models .

• Oxytocin Neuron Pathway: TRPC5 is highly expressed in oxytocin neurons in the paraventricular nucleus of the hypothalamus (PVH). These neurons regulate energy balance, stress response, emotion, and social behaviors including mother-infant bonding. Removal of the TRPC5 gene from PVH oxytocin neurons causes severe overeating and obesity in both sexes, as well as postpartum depressive behavior and reduced maternal care in females .

Interestingly, virgin female mice with TRPC5 mutations do not show depression-like behavior, indicating a specific role for TRPC5 in postpartum depression. Overexpression of functional TRPC5 in neurons of mice carrying defective genes improves these conditions, suggesting potential therapeutic approaches .

How does the binding of compounds like Pico145 modify TRPC5 structure and function?

These structural insights provide a foundation for rational drug design targeting TRPC5 for conditions like obesity and postpartum depression .

What are the optimal conditions for reconstituting recombinant bovine TRPC5 protein?

For optimal reconstitution of lyophilized recombinant bovine TRPC5 protein:

• Briefly centrifuge the vial before opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage

• Aliquot to avoid repeated freeze-thaw cycles

• Store working aliquots at 4°C for up to one week

• For long-term storage, keep at -20°C/-80°C

The protein is supplied in a Tris/PBS-based buffer with 6% Trehalose (pH 8.0), which helps maintain stability during lyophilization and reconstitution . Researchers should validate protein functionality after reconstitution using appropriate activity assays.

What experimental approaches are most effective for studying TRPC5-dependent calcium entry?

Several experimental approaches have proven effective for studying TRPC5-dependent calcium entry:

• Genetic Manipulation:

  • RNA interference (shRNA) for knockdown studies

  • Overexpression systems using plasmid vectors

  • CRISPR/Cas9 gene editing for knockout models

• Calcium Imaging Techniques:

  • Fluorescent calcium indicators (Fura-2, Fluo-4)

  • Bioluminescent calcium sensors

  • Genetically encoded calcium indicators (GCaMPs)

• Electrophysiological Methods:

  • Patch-clamp recordings to measure channel currents

  • Planar patch-clamp systems for higher throughput

• Pharmacological Tools:

  • Store-depleting agents (thapsigargin)

  • Specific TRPC5 inhibitors (Pico145)

  • Cation substitution experiments (Sr²⁺ vs Ca²⁺)

A particularly informative approach is to measure both Sr²⁺ and Ca²⁺ entry, as TRPC5 uniquely permits significant Sr²⁺ influx compared to Orai1-only channels . This differential permeability provides a functional signature of TRPC5 activity. Additionally, measuring downstream processes like mast cell degranulation can provide functional readouts of TRPC5 activity, as studies have shown that knockdown of TRPC5, STIM1, or Orai1 significantly impairs antigen-stimulated degranulation .

How can researchers distinguish between TRPC5-mediated and Orai1-mediated calcium entry?

Distinguishing between TRPC5-mediated and Orai1-mediated calcium entry requires careful experimental design:

• Cation Selectivity Analysis: TRPC5+STIM1 permits both Sr²⁺ and Ca²⁺ influx, while Orai1+STIM1 allows only Ca²⁺ influx . Researchers can leverage this difference by:

  • Performing parallel measurements with equimolar Sr²⁺ and Ca²⁺

  • Calculating Sr²⁺/Ca²⁺ permeability ratios

  • Using Sr²⁺ as a functional tracer for TRPC5 activity

• Specific Inhibitors:

  • Xanthine-based compounds like Pico145 that target the lipid binding site of TRPC5

  • Selective Orai1 inhibitors

  • Comparative inhibition profiles to determine channel contributions

• Biophysical Characterization:

  • Current-voltage relationships (TRPC5 shows distinctive double-rectification)

  • Single-channel conductance measurements

  • Ion selectivity profiles

• Molecular Approaches:

  • Selective knockdown/knockout with functional rescue experiments

  • Mutational analysis of key residues specific to each channel

  • Co-immunoprecipitation to identify protein complexes

A comprehensive data table for distinguishing these channels would include:

By combining these approaches, researchers can accurately determine the relative contributions of TRPC5 and Orai1 to calcium signaling in their experimental system.

What evidence supports TRPC5 as a potential therapeutic target for obesity and postpartum depression?

Several lines of evidence establish TRPC5 as a promising therapeutic target:

• Human Genetic Evidence: Alterations in the human TRPC5 gene are associated with obesity and postpartum depression. Studies identified boys with intense food-seeking behavior and severe obesity who were missing the TRPC5 gene on their X chromosomes. Their mothers, who were carriers (one X chromosome missing TRPC5), experienced obesity, anxiety, and postpartum depression .

• Animal Model Validation: Mouse models with defective TRPC5 variants recapitulate human phenotypes:

  • Male mice gained weight on high-fat diets and showed anxiety, increased arousal, and reduced sociability

  • Female mice exhibited depression-like behavior after giving birth and impaired maternal-offspring interactions

  • Importantly, virgin female mice did not show depression-like behavior, highlighting TRPC5's specific role in postpartum depression

• Neuronal Mechanism Identification: TRPC5 acts on distinct neuronal populations in the hypothalamus:

  • In Pomc neurons (regulating appetite)

  • In oxytocin neurons (regulating energy balance, stress, emotion, and maternal behaviors)

• Intervention Studies: Overexpression of functional TRPC5 in the neurons of mice carrying the defective gene improved their condition, suggesting therapeutic potential .

These findings suggest that TRPC5 modulators could potentially address both obesity and postpartum depression, representing a novel therapeutic strategy for these significant global health problems.

What are the most promising areas for future TRPC5 research?

Based on current findings, several promising research directions emerge:

• Structure-Based Drug Design: The elucidation of TRPC5's structure, particularly its lipid binding site interaction with compounds like Pico145 , provides a foundation for developing selective modulators with therapeutic potential.

• Sex-Specific Mechanisms: Given the findings that TRPC5 dysfunction affects males and females differently and has specific roles in postpartum depression , investigating sex-specific mechanisms could yield important insights.

• Translational Studies: Moving from the identified mechanisms in animal models to human studies represents an important next step. Screening for TRPC5 alterations in patients with obesity and/or postpartum depression could improve diagnostic approaches .

• Regulatory Networks: Further investigation of how TRPC5 interacts with Orai1 and STIM1 in different tissues and cell types could reveal tissue-specific regulatory mechanisms .

• Therapeutic Development: Development and testing of TRPC5 modulators that can cross the blood-brain barrier and target specific neuronal populations represent an exciting frontier for potential treatments.