Recombinant Bovine Sideroflexin-4 (SFXN4)

Shipped with Ice Packs
In Stock

Description

Research Findings in Mitochondrial Diseases

SFXN4 mutations are linked to severe mitochondrial disorders:

  • Clinical Features:

    • Macrocytic Anemia: Due to impaired erythropoiesis and Fe-S cluster deficits .

    • Mitochondrial Defects: Isolated complex I deficiency, reduced ATP production, and glycolytic shift .

  • Mechanistic Insights:

    • Complex I Assembly: SFXN4 interacts with the MCIA complex to integrate mtDNA-encoded ND6 into the ND2 module of complex I .

    • Iron Metabolism: Regulates cytosolic aconitase-IRP1 switch, altering iron distribution between cytosol and mitochondria .

Table 2: SFXN4-Related Mitochondrial Disorders

DisorderGenetic CauseKey Phenotypes
Combined OXPHOS Deficiency 18SFXN4 mutationsMacrocytic anemia, optic nerve hypoplasia
Ischemic StrokeSFXN4 SNP (rs150807690)Stroke susceptibility

Role in Hepatocellular Carcinoma (HCC)

SFXN4 is upregulated in HCC and associated with aggressive phenotypes:

  • Prognostic Biomarker: High expression correlates with poor survival, metastasis, and tumor recurrence .

  • Mechanisms in HCC:

    • Proliferation: Knockdown reduces cyclin D1 expression and inhibits cell cycle progression .

    • Migration/Invasion: Downregulates MMP2, limiting extracellular matrix remodeling .

    • Metabolic Reprogramming: Promotes oxidative phosphorylation and reactive oxygen species (ROS) production .

Table 3: SFXN4 in HCC Pathogenesis

ProcessExperimental EvidenceClinical Correlation
ProliferationCCK-8/EdU assays (Huh7, MHCC97H)High SFXN4 = poor prognosis
Tumor GrowthXenograft models (mice)Metastasis, recurrence
Drug SensitivityGSCALite database analysisResponsive to Vorinostat, resistant to TGX221

Therapeutic Potential and Drug Sensitivity

SFXN4 expression predicts responsiveness to targeted therapies:

  • Responsive Drugs:

    • Vorinostat: HDAC inhibitor targeting apoptosis pathways.

    • Methotrexate: Dihydrofolate reductase inhibitor affecting nucleotide synthesis.

  • Resistant Drugs:

    • TGX221: Keap1-Nrf2 inhibitor (no efficacy in SFXN4-high HCC).

    • Dasatinib: Src/Bcr-Abl inhibitor (ineffective in SFXN4-driven models) .

Clinical and Research Implications

  • Diagnostic Utility: SFXN4 expression levels may stratify HCC patients for targeted therapies .

  • Therapeutic Targeting: Inhibiting SFXN4 could disrupt mitochondrial respiration in HCC, synergizing with glycolysis inhibitors .

  • Mitochondrial Diseases: Replacement therapy or gene editing may address SFXN4 mutations causing anemia and respiratory defects .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, we recommend adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please provide this information during your order. We will prioritize developing the specified tag if possible.
Synonyms
SFXN4; Sideroflexin-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SFXN4
Target Protein Sequence
MEPNVRFWITERQSFIQRFLQWTELLDPTNLVLSIEKIEKSRQLLLTNEDASRGDLEDKR IQEAWKRSLSTVHPDNSRLIPGPFRPAALLPFTAPTLFLSMLPVKSLKSMILPQASFYTY STAFNIVNGNASYDRRAHESLLLGAGVIVSSTFLGLFPRLLQVRLSMNSVLSRNFIPVII LAQLSGMNVIASRSLEPMRGIEVMDKEGNVIGYSRKAGTKAVKDTATSRVVLFGTSAFIP EVFAYFFKRTQFFLQNPWSLWTLKLSCTVLVMGLMVPVSFSVFPQIGRIQCNELEKEIQS ATEETELFYNRGV
Uniprot No.

Target Background

Function
Sideroflexin-4 (SFXN4) is a mitochondrial amino-acid transporter. It does not function as a serine transporter and is unable to mediate the transport of serine into mitochondria.
Database Links
Protein Families
Sideroflexin family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Sideroflexin-4 and how does it differ from other sideroflexin family proteins?

Sideroflexin-4 (SFXN4) is an integral inner mitochondrial membrane protein that has functionally diverged from other members of the sideroflexin family. While sideroflexins 1, 2, and 3 function primarily as serine transporters, SFXN4 has evolved to assist in the assembly of respiratory chain complex I . This functional divergence is evident in gene coessentiality analysis, which shows SFXN4 clusters with complex I subunits and assembly factors, a pattern not observed with other SFXN family members . The protein contains multiple transmembrane domains characteristic of the sideroflexin family and has been identified in multiple isoforms, including one that lacks the first ~115 amino acids but retains all five predicted transmembrane domains .

What is the primary function of SFXN4 in mitochondria?

SFXN4 serves as a complex I assembly factor, specifically interacting with the MCIA (Mitochondrial Complex I Assembly) complex and assisting in the assembly of the ND2 module of complex I . Research demonstrates that SFXN4 interacts with newly synthesized ND6, one of the last subunits to be added to this module . This assembly function is critical for mitochondrial respiration, as complex I (NADH:ubiquinone oxidoreductase) is the first and largest enzyme of the mitochondrial respiratory chain responsible for electron transfer and proton pumping across the inner mitochondrial membrane . Additionally, SFXN4 may play a role in iron-sulfur (Fe-S) cluster biogenesis, though its mechanism appears distinct from its complex I assembly function .

How can researchers detect and localize SFXN4 in cellular models?

Multiple complementary techniques can be employed to detect SFXN4 expression and localization:

  • Western blotting: Using specific anti-SFXN4 antibodies for protein expression levels

  • Immunofluorescence microscopy: Co-staining with mitochondrial markers to confirm mitochondrial localization

  • Subcellular fractionation: Followed by Western blotting to verify presence in mitochondrial fractions

  • Blue-Native PAGE: For visualization of SFXN4-containing complexes

  • Immunoprecipitation: Followed by mass spectrometry to identify binding partners

When designing expression vectors for recombinant SFXN4, C-terminal tags appear to preserve function, as FLAG-tagged SFXN4 successfully rescues complex I defects in SFXN4 knockout cells .

How does SFXN4 contribute to complex I assembly?

SFXN4 plays a specific role in the assembly of the ND2 module of complex I through extensive interactions with the MCIA (Mitochondrial Complex I Assembly) complex. Affinity enrichment mass spectrometry experiments have identified that the three most enriched proteins in SFXN4 pull-down experiments are ECSIT, ACAD9, and NDUFAF1, which are established assembly factors for complex I . These proteins showed a high degree of coessentiality with SFXN4 in gene essentiality dataset analysis, providing strong evidence for functionally relevant interactions .

Blue-Native PAGE analysis reveals that SFXN4 is present in high-molecular-weight complexes that co-migrate with MCIA complex components, representing different assembly intermediates of complex I . The arrangement of these MCIA-containing complex I assembly intermediates is dramatically altered in SFXN4 knockout cells, particularly affecting the Q/PP assembly intermediates .

Table 1: Key Protein Interactions of SFXN4 in Complex I Assembly

ProteinFunctionInteraction EvidenceRole in Complex I Assembly
ECSITMCIA complex componentHighly enriched in AP-MSAssembly of ND2 module
ACAD9MCIA complex componentHighly enriched in AP-MSAssembly of ND2 module
NDUFAF1MCIA complex componentHighly enriched in AP-MSAssembly of ND2 module
TIMMDC1Assembly factorDetected in higher MW complexAssembly of ND1 module
ND6mtDNA-encoded subunitDirect interaction detectedLate addition to ND2 module

What are the consequences of SFXN4 deficiency on mitochondrial function?

SFXN4 deficiency has profound effects on mitochondrial respiration and energy production. Research demonstrates that SFXN4 knockout cells exhibit:

  • Approximately 70% reduction in complex I enzymatic activity

  • Significant reduction in complex I-containing supercomplexes and holoenzymes

  • Impaired ATP production when provided with complex I substrates (glutamate + malate, pyruvate + malate)

  • Reduced basal and maximal oxygen consumption rates

  • Loss of glycolytic reserve, suggesting metabolic adaptation to rely on glycolysis for ATP production

Importantly, this represents an isolated complex I defect, as the activities of complexes II, III, and IV remain largely unaffected . This specific impact on complex I-dependent respiration while sparing other complexes confirms that SFXN4's primary role is in complex I assembly rather than having a broader role in mitochondrial function.

Table 2: Impact of SFXN4 Knockout on Mitochondrial Respiratory Chain Complexes

ComplexActivity Change in SFXN4 KOSupercomplex FormationFunctional Impact
Complex I~70% reductionSeverely reducedImpaired NADH oxidation
Complex IINo significant changeN/ANormal succinate oxidation
Complex IIINo significant changeAbsent from supercomplexSlightly increased abundance as holoenzyme
Complex IVNo significant changeAbsent from supercomplexNormal activity

How is SFXN4 involved in iron-sulfur (Fe-S) cluster biogenesis?

Interestingly, while complex I (which contains multiple Fe-S clusters) is severely affected by SFXN4 deletion, other Fe-S-containing proteins and complexes (including complexes II and III) remain largely unaffected . This selective impact suggests that SFXN4's role in Fe-S biogenesis might be specific to certain Fe-S clusters or proteins, particularly those involved in complex I assembly.

What methodologies can be used to investigate SFXN4's role in Fe-S cluster biogenesis?

To investigate SFXN4's role in Fe-S cluster biogenesis, researchers can employ several complementary approaches:

  • Enzyme activity assays: Measure the activity of Fe-S dependent enzymes (e.g., aconitase, complex I) in SFXN4-depleted vs. control cells

  • Iron homeostasis measurements: Quantify labile iron pool levels using fluorescent probes or ICP-MS to detect iron accumulation following SFXN4 depletion

  • 55Fe incorporation assays: Track the incorporation of radioactive iron into Fe-S proteins to assess de novo Fe-S cluster assembly

  • Protein interaction studies: Identify interactions between SFXN4 and known Fe-S cluster assembly components

  • Rescue experiments: Test whether supplementation with Fe-S cluster precursors or expression of other Fe-S assembly factors can rescue phenotypes in SFXN4-deficient cells

When designing these experiments, researchers should consider that SFXN4's role may be specific to certain Fe-S proteins rather than affecting all Fe-S cluster biogenesis pathways .

What diseases are associated with SFXN4 mutations or dysfunction?

SFXN4 dysfunction is associated with two main disease contexts:

  • Mitochondrial disease: Mutations in SFXN4 cause mitochondrial disease characterized by complex I deficiency . Since complex I is critical for ATP production via oxidative phosphorylation, SFXN4 mutations typically result in multisystem disorders affecting tissues with high energy demands .

  • Cancer: SFXN4 has been implicated in cancer biology, particularly ovarian cancer . SFXN4 inhibition can sensitize ovarian cancer cells to DNA-damaging drugs and DNA repair inhibitors like cisplatin and PARP inhibitors . This occurs through a dual mechanism: SFXN4 inhibition leads to both oxidative stress from iron accumulation and impaired DNA repair, making cancer cells more vulnerable to DNA-damaging therapies .

How does SFXN4 inhibition sensitize cancer cells to chemotherapy?

SFXN4 inhibition triggers two complementary anti-cancer mechanisms that enhance the effectiveness of DNA-damaging chemotherapeutics:

  • Oxidative stress induction: Inhibition of SFXN4 disrupts iron-sulfur (Fe-S) cluster biogenesis, leading to accumulation of excess iron in cancer cells . Through participation in the Fenton reaction and other pathways, this excess iron contributes to oxidative stress, which can damage cancer cells .

  • DNA repair inhibition: Many enzymes critical to multiple DNA repair pathways require Fe-S clusters for their function . By inhibiting Fe-S biogenesis, SFXN4 knockdown compromises these DNA repair enzymes, hindering the cell's ability to repair DNA damage .

This dual mechanism makes SFXN4 inhibition particularly effective at sensitizing ovarian cancer cells to cisplatin and PARP inhibitors, even in drug-resistant lines . Furthermore, knockout of SFXN4 has been shown to decrease DNA repair capacity and profoundly inhibit tumor growth in mouse models of ovarian cancer metastasis .

What are optimal expression and purification conditions for recombinant bovine SFXN4?

When expressing and purifying recombinant bovine SFXN4, researchers should consider the following optimization strategies:

  • Expression systems:

    • Mammalian expression (HEK293 cells) has been successfully used for SFXN4 expression as demonstrated in complementation studies

    • E. coli systems may require specialized vectors with solubility tags (MBP, GST, SUMO)

  • Construct design:

    • C-terminal tags appear to preserve function (FLAG-tagged SFXN4 rescues complex I defects)

    • Consider expressing multiple isoforms, including the shorter isoform 3 which retains all transmembrane domains

  • Purification approach:

    • Two-step purification: affinity chromatography followed by size exclusion chromatography

    • Critical use of appropriate detergents (digitonin or Triton X-100 have been successfully used for solubilization in functional studies)

    • Include stabilizing agents (glycerol 10-15%) and reducing agents in buffers

  • Functional verification:

    • Ability to rescue complex I assembly and activity in SFXN4 knockout cell lines

    • Formation of appropriate high-molecular-weight complexes as assessed by BN-PAGE

What CRISPR-Cas9 strategies are most effective for studying SFXN4 function?

CRISPR-Cas9 technology provides powerful approaches for studying SFXN4 function. When designing knockout strategies, researchers should consider:

  • gRNA design:

    • Target regions common to all isoforms to ensure complete elimination of SFXN4 function

    • The search results mention that SFXN4 has multiple isoforms, including one (isoform 3) that lacks the first ~115 amino acids but still contains all transmembrane domains

  • Knockout validation:

    • Verify loss of protein by Western blot

    • Confirm functional defect through complex I activity assays

    • Assess complex I assembly state through BN-PAGE analysis

  • Advanced CRISPR applications:

    • Knock-in strategies to introduce specific mutations or tagged versions at the endogenous locus

    • CRISPR interference (CRISPRi) for tunable repression of SFXN4 expression

    • Inducible CRISPR systems to study acute versus chronic effects of SFXN4 loss

  • Phenotypic analysis:

    • Blue-Native PAGE to examine complex I assembly intermediates

    • Oxygen consumption measurements to assess respiratory capacity

    • ATP production assays with complex I substrates

Complete SFXN4 knockout has been shown to result in complex I deficiency, reduced oxygen consumption, and impaired ATP production , providing clear functional readouts for successful gene editing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.