Recombinant Bovine Signal peptidase complex subunit 1 (SPCS1)

Shipped with Ice Packs
In Stock

Description

Role in Viral Protein Processing and Assembly

SPCS1 is indispensable for the posttranslational processing and virion assembly of flaviviruses. Key findings include:

Interaction with Viral Proteins

SPCS1 directly interacts with nonstructural proteins (NS2B in flaviviruses) to regulate assembly:

  • NS2B Transmembrane Domains: SPCS1 binds to NS2B(1–49) and NS2B(84–131) in JEV, WNV, and ZIKV, facilitating virion formation .

  • HCV NS2: SPCS1 interacts with HCV NS2, though the mechanism differs from flaviviruses .

SPCS1-Dependent Substrate Presentation

SPCS1 enhances the accessibility of SPC to suboptimal cleavage sites by:

  • Modulating Signal Peptide Hydrophobicity: SPCS1 may stabilize interactions between SPC and hydrophobic signal peptides .

  • Regulating SPC Activity: SPCS1 indirectly influences SPC catalysis, particularly under stress conditions .

Viral Assembly Model

In flaviviruses, SPCS1 interacts with NS2B, which associates with NS2A during virion formation. This interaction network is hypothesized to coordinate viral protein processing and lipid envelope assembly .

Research Gaps and Future Directions

  • Bovine-Specific Data: No studies explicitly address bovine SPCS1. Current insights derive from human and viral systems.

  • Structural Resolution: High-resolution structures of SPCS1 in complex with viral proteins or SPC subunits remain unresolved.

  • Therapeutic Potential: Inhibiting SPCS1 could broadly target Flaviviridae viruses, but off-target effects on host protein secretion must be evaluated .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please specify them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
SPCS1; Signal peptidase complex subunit 1; Microsomal signal peptidase 12 kDa subunit; SPase 12 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SPCS1
Target Protein Sequence
MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYLAEQFGWTVYIVMAGFAFSC LLTLPPWPIYRRHPLKWLPVQDSSTEDKKPGERKVKRHAKNN
Uniprot No.

Target Background

Function
Signal peptidase complex subunit 1 (SPCS1) is a component of the microsomal signal peptidase complex. This complex is responsible for removing signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
Database Links
Protein Families
SPCS1 family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of SPCS1 in mammalian cells?

SPCS1 functions as a component of the microsomal signal peptidase complex (SPC) that is responsible for the cleavage of signal peptides from many secreted and membrane-associated proteins . While not the catalytic subunit itself, SPCS1 plays a regulatory role in facilitating specific cleavage events by the SPC. Studies suggest it affects the processing of selected protein substrates, particularly those with suboptimal cleavage sites, by enhancing substrate presentation to the SPC active site .

How conserved is SPCS1 across mammalian species including bovine?

SPCS1 is highly conserved across mammalian species, reflecting its fundamental role in protein processing. While the search results don't specifically address bovine SPCS1, comparative studies examining SPCS1 in other mammals show functional conservation. The yeast homolog of SPCS1 (Spc1p) was shown to be nonessential for general signal peptidase activity but became important under specific conditions, such as when abnormal membrane proteins were overexpressed . This evolutionary conservation suggests bovine SPCS1 likely maintains similar structural and functional characteristics to its mouse and human counterparts.

What cellular phenotypes are observed in SPCS1-deficient cells?

SPCS1-deficient cells show specific defects in protein processing rather than general disruption of the secretory pathway. Studies with SPCS1 knockout cells demonstrate that:

  • Normal processing of most cellular signal-anchored or transmembrane proteins is maintained

  • Host protein secretion and surface expression remain largely intact

  • Specific substrates with suboptimal cleavage sites show impaired processing

  • Viral protein processing, particularly of flaviviruses and HCV, is significantly impaired

What are the optimal expression systems for producing functional recombinant bovine SPCS1?

Based on approaches used for other mammalian SPCS1 proteins, mammalian expression systems are recommended for recombinant bovine SPCS1 production to ensure proper folding and post-translational modifications. Key methodological considerations include:

  • Expression System Selection: HEK293 or CHO cells provide suitable mammalian expression environments with proper ER processing machinery

  • Purification Strategy: His-tagged SPCS1 allows for efficient purification while maintaining function

  • Buffer Conditions: PBS buffer has been successfully used for protein storage

  • Quality Control: Ensuring >80% purity via SDS-PAGE and confirming low endotoxin levels (<1.0 EU per μg protein) using LAL method

What methodologies are most effective for studying SPCS1 interactions with viral proteins?

Several complementary approaches have proven effective for investigating SPCS1-viral protein interactions:

  • Bimolecular Fluorescence Complementation (BiFC)

    • Particularly effective for visualizing interactions between SPCS1 and membrane proteins

    • In published studies, SPCS1 was fused to the N-terminal fragment of Venus protein (VN) while viral proteins were fused to C-terminal Venus fragments (VC)

    • Positive interactions reconstitute fluorescent Venus protein, enabling visualization and quantification

  • Co-immunoprecipitation

    • Used to confirm interactions identified through BiFC

    • Example protocol: Co-express myc-tagged SPCS1 with FLAG-tagged viral proteins in HEK-293T cells, followed by immunoprecipitation and western blotting

  • Split-Ubiquitin Membrane Yeast Two-Hybrid Assay

    • Particularly useful for initial screening of transmembrane protein interactions

    • Successfully used to identify SPCS1 as an interactor with HCV NS2

How can researchers effectively establish and validate SPCS1 knockout/knockdown models?

Knockout Generation Protocol:

  • CRISPR-Cas9 system has been effectively used to generate SPCS1 knockout cell lines

  • Target guide RNAs should be designed against conserved regions

  • Validation should include:

    • Western blot confirmation of protein absence

    • Sequencing confirmation of genomic modification

Knockdown Model:

  • shRNA-mediated knockdown has been successfully employed for SPCS1

  • Example: Transfection with plasmids encoding shRNA targeted to SPCS1 followed by hygromycin B selection

Validation and Rescue Experiments:

  • Confirmation of knockdown efficiency by western blotting

  • Functional validation through viral infection assays

  • Specificity confirmation through rescue experiments by transfecting shRNA-resistant SPCS1 expression plasmids

How does SPCS1 regulate the life cycle of different Flaviviridae family viruses?

SPCS1 regulates Flaviviridae virus propagation through distinct but related mechanisms:

Japanese Encephalitis Virus (JEV):

  • SPCS1 interacts with JEV NS2B protein through its transmembrane domains

  • This interaction influences posttranslational processing of viral proteins

  • SPCS1 is critical for virion assembly but not for viral cell entry, RNA replication, or translation

Hepatitis C Virus (HCV):

  • SPCS1 specifically facilitates SPC-mediated processing of the E2-p7 junction

  • Forms a complex with NS2 and E2 proteins

  • Knockdown of SPCS1 impairs interaction between NS2 and E2, hindering viral assembly

  • Unlike with flaviviruses, early studies suggested JEV propagation was not affected by SPCS1 knockdown, though later research revealed its importance across Flaviviridae

Other Flaviviruses (WNV, DENV, ZIKV, YFV):

  • SPCS1 is required for proper cleavage of flavivirus structural proteins, particularly the C-prM junction

  • Loss of SPCS1 markedly reduces yield of all tested Flaviviridae members

What are the structural determinants of SPCS1 that mediate its interaction with viral proteins?

Key structural elements of SPCS1 that mediate viral protein interactions include:

  • Transmembrane Domains: SPCS1(91-169), containing two transmembrane domains, interacts with NS2B of JEV

  • Interaction Specificity: Mutagenesis studies of viral proteins that interact with SPCS1 have identified specific conserved residues important for these interactions:

    • For JEV NS2B: Residues G12, G37, G47 in NS2B(1-49) and P112 in NS2B(84-131) are critical for SPCS1 interaction

    • For HCV: E2-p7 junction presentation to the SPC is facilitated by SPCS1

  • Proposed Model: Research suggests SPCS1 functions by enhancing the presentation of suboptimal cleavage sites to the SPC catalytic site, particularly for viral protein junctions that are otherwise structurally hindered from efficient processing

How does the role of SPCS1 in viral infections inform potential antiviral strategies?

SPCS1 represents a promising host-directed antiviral target based on several key findings:

  • Broad Spectrum Activity: SPCS1 is required for the propagation of multiple clinically important Flaviviridae viruses, including HCV, JEV, WNV, DENV, ZIKV, and YFV

  • Viral Specificity: Targeting SPCS1 shows selective inhibition of Flaviviridae viruses without affecting alphaviruses, bunyaviruses, or rhabdoviruses

  • Minimal Host Impact: Loss of SPCS1 has limited effects on general host protein processing, suggesting potential for therapeutic targeting with minimal toxicity

  • Escape Resistance: Viral escape would require fundamental changes to viral protein processing, which is likely to impair fitness

  • Experimental Bypass: The dependence on SPCS1 can be bypassed by replacing native viral leader sequences with alternative signal sequences (such as MHC class I signals), providing proof-of-concept for the mechanism

What experimental design considerations are important when analyzing SPCS1's role in protein processing events?

When designing experiments to investigate SPCS1's role in protein processing:

  • Time-Course Analysis: Processing of viral polyproteins should be analyzed through pulse-chase experiments to distinguish between effects on initial cleavage versus protein stability

    • Example protocol: Metabolic labeling with 35S-methionine followed by immunoprecipitation at different time points post-labeling

  • Subcellular Localization Studies:

    • Viral protein processing defects in SPCS1-deficient cells should be correlated with alterations in subcellular localization

    • Immunofluorescence microscopy combined with ER, Golgi, and viral protein markers is recommended

  • Comparative Analysis of Processing Events:

    • Include multiple cleavage sites in the same experimental system to distinguish site-specific effects

    • For flaviviruses, compare C-prM, prM-E, E-NS1 junctions

    • For HCV, compare E1-E2, E2-p7, and p7-NS2 junctions

  • Mutagenesis Strategy:

    • Design mutations at cleavage junctions that alter processing efficiency

    • Evaluate how SPCS1 dependency changes with altered junction sequences

How can in silico approaches complement experimental studies of SPCS1 function?

In silico methods provide valuable insights into SPCS1 function:

  • Structural Modeling and Molecular Dynamics (MD) Simulations:

    • MD simulations have revealed that processing inefficiency at the HCV E2-p7 junction likely results from the structural rigidity of p7 N-terminal transmembrane helix-1, which maintains membrane-embedded conformations

    • E2-p7-processing-impairing mutations narrowed the p7/TM1/helix-1 bending angle against the membrane, resulting in less access of the junction to the SPC catalytic site

  • Sequence Analysis Across Species:

    • Comparative analysis of SPCS1 sequences from different mammalian species can identify conserved functional regions

    • Conservation mapping onto structural models can predict functional domains

  • Prediction of Suboptimal Cleavage Sites:

    • Computational algorithms can predict processing efficiency of signal sequences

    • These predictions can be used to identify potential SPCS1-dependent substrates for experimental validation

What quality control measures should be implemented when working with recombinant bovine SPCS1?

Comprehensive quality control for recombinant bovine SPCS1 should include:

  • Purity Assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (target >80% purity)

    • Western blot confirmation of identity

  • Functional Validation:

    • Binding assays with known interaction partners (like viral proteins)

    • Signal peptide processing enhancement assays using model substrates

  • Structural Integrity:

    • Circular dichroism spectroscopy to confirm proper folding

    • Limited proteolysis to assess domain organization

  • Endotoxin Testing:

    • LAL method to ensure endotoxin levels below 1.0 EU per μg protein

  • Storage and Stability:

    • Assess protein stability in storage buffer (PBS recommended)

    • Conduct freeze-thaw stability tests

What are the unexplored aspects of SPCS1 function in protein quality control?

Several important knowledge gaps remain in understanding SPCS1 function:

How can SPCS1 research contribute to understanding viral evolution?

SPCS1 dependency of viruses raises interesting evolutionary questions:

  • Comparative Virology:

    • Why do Flaviviridae family viruses specifically depend on SPCS1 while other virus families do not?

    • Evolutionary analysis of viral protein processing sites across different virus families could reveal adaptations to SPC processing

  • Adaptation to Host Factors:

    • Investigation of species-specific variations in SPCS1 and corresponding adaptations in viral proteins that interact with SPCS1

    • This could provide insights into viral host range and zoonotic potential

  • Evolutionary Constraints:

    • The dependence on SPCS1 may represent an evolutionary constraint for flaviviruses

    • Understanding this constraint could help predict evolutionary trajectories and potential emerging threats

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.