Recombinant Bovine Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2 (NKAIN2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate your preferences when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be established during the production process. If you have a preferred tag type, please communicate it to us and we will prioritize developing the specified tag.
Synonyms
NKAIN2; Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2; Na(+/K(+-transporting ATPase subunit beta-1-interacting protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
NKAIN2
Target Protein Sequence
MGYCSGRCTLIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPR YITGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSV TPAPDWAPEDHRYITVSGCFLEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFD FIGGFDSYGYQGPQKTSHLQLQPMYMQIPLDNN
Uniprot No.

Target Background

Database Links

KEGG: bta:787444

UniGene: Bt.66660

Protein Families
NKAIN family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of bovine NKAIN2 and how does it compare to other species?

NKAIN2 belongs to a superfamily of transmembrane proteins that interact with the β1 subunits of Na+/K+-ATPase. The gene consists of eight coding exons spanning approximately 1 Mb of genomic DNA on chromosome 6q. Four main splice variants have been identified, including two short isoforms containing four exons and two long isoforms containing seven exons .

The NKAIN family shows striking evolutionary conservation among species, with particularly strong amino acid conservation in the first two transmembrane domains from Drosophila to human, indicating significant functional importance . The protein contains a DUF798 domain (Domain of Unknown Function), which is phylogenetically well conserved .

GeneLocationExpressionInvolvement in diseases
NKAIN11p35.2Neuron-specificAlcohol dependence
NKAIN26q22.31Neuron-specificGenital herpes, alcohol dependence, lymphoma, neuroblastoma, prostate cancer, type 2 diabetes mellitus
NKAIN38q12.13Neuron-specific-
NKAIN420q13.33Ubiquitous-

Table 1: Comparison of NKAIN family members characteristics

What expression systems are most effective for producing recombinant bovine NKAIN2?

Escherichia coli (E. coli) is frequently used for the recombinant expression of NKAIN2 and similar proteins due to its established protocols, cost-effectiveness, and high yield. Based on findings from comparable recombinant protein studies, a prokaryotic expression system using E. coli can produce significant yields of soluble recombinant protein .

For optimal expression, consider the following methodological approach:

  • Clone the bovine NKAIN2 cDNA sequence into a suitable expression vector with an appropriate tag (such as GST, which has been successfully used for human NKAIN2)

  • Transform the construct into an E. coli strain optimized for recombinant protein expression (such as BL21(DE3))

  • Use experimental design approaches to optimize expression conditions:

    • Test multiple induction temperatures (typically 16°C, 25°C, and 37°C)

    • Vary IPTG concentrations (0.1-1.0 mM)

    • Adjust induction times (4-24 hours)

    • Test different media formulations

In one study involving recombinant protein expression, researchers achieved high levels (250 mg/L) of soluble functional protein in E. coli through systematic optimization of process conditions .

What are the recommended storage and handling conditions for recombinant bovine NKAIN2?

Based on protocols for similar recombinant proteins, the following storage conditions are recommended:

  • Short-term storage: Store at 2-8°C for 1-2 weeks

  • Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months

  • For lyophilized protein: Reconstitute with sterile water and add an equal volume of glycerol

  • Avoid repeated freeze-thaw cycles

For optimal stability during lyophilization, the purified protein can be lyophilized from sterile PBS (58mM Na₂HPO₄, 17mM NaH₂PO₄, 68mM NaCl, pH 7.4) with 5% trehalose and 5% mannitol added as protectants .

How should researchers design experiments to investigate bovine NKAIN2 function?

When designing experiments to study bovine NKAIN2 function, a block design approach is particularly useful. This experimental paradigm consists of alternating task blocks with rest periods, which helps establish stable baseline measurements and improves statistical power .

Key methodological considerations:

  • Block Design Implementation:

    • Use task blocks with fixed durations (typically 20-30 seconds)

    • Include sufficient rest periods (30-45 seconds) between blocks to allow the response to return to baseline

    • Incorporate multiple repetitions of blocks for statistical robustness

  • Controls:

    • Include both positive controls (known interacting partners like Na+/K+-ATPase β1 subunit)

    • Use negative controls (non-interacting proteins of similar size/structure)

    • Consider using NKAIN family members (NKAIN1, NKAIN3, NKAIN4) for comparative analysis

  • Randomization:

    • If multiple treatments are being tested, randomize their order to prevent anticipation effects

    • Perform test trials before actual data collection to ensure stable performance and avoid learning effects

For example, when studying NKAIN2 interaction with Na+/K+-ATPase, researchers could design blocks of different experimental conditions (varying concentrations, presence of inhibitors, etc.) with rest periods in between to establish clear baseline measurements.

What optimization approaches can improve recombinant bovine NKAIN2 expression?

Experimental design methodology can significantly enhance recombinant protein expression. The following systematic approach is recommended:

  • Factorial Design Optimization:

    • Apply a Design of Experiments (DoE) approach to identify critical parameters affecting expression

    • Test factorial combinations of temperature, inducer concentration, media composition, and induction time

    • Analyze results to identify optimal conditions that maximize soluble protein yield

  • Expression Vector and Tag Selection:

    • Test multiple fusion tags (His, GST, MBP) to improve solubility

    • GST tagging has shown success with human NKAIN2 and could be effective for the bovine homolog

    • Consider codon optimization for E. coli if expression levels are low

  • Solubility Enhancement:

    • Co-express with molecular chaperones if inclusion body formation is observed

    • Test various lysis buffers with different detergents for optimal extraction

    • Consider lowering induction temperature to 16-20°C to slow expression and improve folding

Following this approach, researchers have achieved high-level soluble expression (250 mg/L) of functional recombinant proteins in E. coli, which can be applied to bovine NKAIN2 expression .

What are the key considerations for in silico analysis of recombinant bovine NKAIN2?

In silico analysis is crucial for predicting protein structure, function, and properties before experimental validation. For recombinant bovine NKAIN2, consider the following methodological approaches:

  • Sequence Analysis:

    • Align bovine NKAIN2 with orthologs from other species to identify conserved domains

    • Use tools like BLAST, Pfam, and ClustalW for comprehensive sequence analysis

    • Identify the DUF798 domain and transmembrane regions that are highly conserved

  • Structural Prediction:

    • Use homology modeling to predict 3D structure based on known structures of related proteins

    • Apply tools like AlphaFold, SWISS-MODEL, or I-TASSER

    • Analyze predicted transmembrane domains and potential interaction sites with Na+/K+-ATPase

  • Function Prediction:

    • Identify potential post-translational modification sites

    • Predict protein-protein interaction motifs, particularly those involved in Na+/K+-ATPase binding

    • Analyze potential phosphorylation sites that might regulate protein function

When conducting in silico analysis, it's important to compare bovine NKAIN2 with the human ortholog, which shows specific interaction with the β1 subunit of Na+/K+-ATPase and has been implicated in nervous system development .

What assays are recommended for validating the interaction between bovine NKAIN2 and Na⁺/K⁺-ATPase?

To validate the interaction between recombinant bovine NKAIN2 and Na⁺/K⁺-ATPase, multiple complementary approaches should be employed:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-NKAIN2 antibodies to pull down the protein complex

    • Probe for Na⁺/K⁺-ATPase β1 subunit using Western blot

    • Include appropriate controls: IgG control, lysates from cells not expressing NKAIN2

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified Na⁺/K⁺-ATPase on a sensor chip

    • Measure binding kinetics of recombinant bovine NKAIN2

    • Determine association (ka) and dissociation (kd) rate constants

    • Calculate equilibrium dissociation constant (KD)

  • Förster Resonance Energy Transfer (FRET):

    • Create fusion constructs of NKAIN2 and Na⁺/K⁺-ATPase with appropriate fluorophores

    • Measure energy transfer in live cells or in vitro

    • Quantify the interaction strength based on FRET efficiency

  • Functional Assays:

    • Measure Na⁺/K⁺-ATPase activity in the presence and absence of NKAIN2

    • Use enzyme activity assays to determine if NKAIN2 modulates ATPase function

    • Test various concentrations of NKAIN2 to establish dose-response relationships

These methodologies provide complementary evidence for protein-protein interactions, with each technique offering different advantages in terms of sensitivity, specificity, and physiological relevance.

How can researchers effectively investigate tissue-specific expression patterns of bovine NKAIN2?

To comprehensively analyze the tissue-specific expression patterns of bovine NKAIN2, a multi-method approach is recommended:

  • Quantitative PCR (qPCR):

    • Design primers specific to bovine NKAIN2 transcript variants

    • Isolate RNA from various bovine tissues

    • Perform qPCR using appropriate reference genes

    • Analyze differential expression across tissues

  • Immunohistochemistry (IHC):

    • Use validated antibodies against bovine NKAIN2

    • Perform IHC on tissue sections from various bovine organs

    • Include appropriate positive controls (known expression sites) and negative controls

    • Quantify expression levels using digital image analysis

  • Western Blot Analysis:

    • Prepare protein extracts from different bovine tissues

    • Perform Western blotting using antibodies against NKAIN2

    • Quantify relative protein expression levels

    • Compare with human expression patterns for evolutionary context

Based on human data, NKAIN2 shows neuron-specific expression and is abundantly expressed in brain tissues . In the Human Protein Atlas, NKAIN2 expression is particularly notable in the hippocampal formation, amygdala, basal ganglia, midbrain, and other brain regions . When investigating bovine tissues, focus particularly on nervous system tissues.

What approaches should be used to study NKAIN2's potential tumor suppressor role in bovine systems?

To investigate the potential tumor suppressor role of bovine NKAIN2, researchers should employ a comprehensive experimental approach:

  • Expression Analysis in Normal vs. Tumor Tissues:

    • Compare NKAIN2 expression levels in normal bovine tissues and tumor samples

    • Use qPCR, Western blot, and immunohistochemistry for comprehensive assessment

    • Analyze correlation between expression levels and tumor grade/stage if available

  • Functional Studies:

    • Use CRISPR-Cas9 to knock out NKAIN2 in bovine cell lines

    • Overexpress NKAIN2 in bovine tumor cell lines with low endogenous expression

    • Assess effects on:

      • Cell proliferation

      • Apoptosis

      • Migration and invasion

      • Colony formation

  • Mechanistic Studies:

    • Identify potential downstream effectors through RNA-seq or proteomics

    • Investigate signaling pathways potentially regulated by NKAIN2

    • Examine potential roles in cell cycle regulation

In human studies, NKAIN2 has been found to be truncated in prostate cancer and deleted in castration-resistant prostate cancer (CRPC) . Inactivation of NKAIN2 appears at the early stage of developing castration resistance. NKAIN2 is also downregulated in human brain and CNS cancers . These findings suggest that NKAIN2 may function as a tumor suppressor in multiple contexts, which could be explored in bovine systems as well.

How should researchers interpret contradictory findings about NKAIN2 function across different experimental systems?

When faced with contradictory findings about NKAIN2 function, researchers should employ a systematic analytical approach:

  • Context-Dependent Analysis:

    • NKAIN2 may have tissue-specific roles—functioning as a tumor suppressor in some contexts while promoting cell growth in others

    • In neuronal tissues, NKAIN2 appears to be required for cell proliferation, with elevated expression detected in neuroblastoma

    • In prostate and other tissues, NKAIN2 appears to function as a tumor suppressor

  • Methodological Comparison:

    • Analyze differences in experimental methods that might explain contradictory results

    • Consider variations in:

      • Expression systems (prokaryotic vs. eukaryotic)

      • Cell types used (primary cells vs. cell lines)

      • Protein tags and their potential interference with function

      • Assay conditions and sensitivity

  • Isoform-Specific Function:

    • Determine which NKAIN2 splice variants were investigated in each study

    • The four main splice variants may have different functions

    • Ensure experiments specify which isoform is being used

  • Species-Specific Differences:

    • Compare bovine and human NKAIN2 sequences to identify potential functional differences

    • Consider evolutionary conservation of specific domains versus species-specific adaptations

When evaluating contradictory findings, consider the biological context carefully. For example, Romania et al. found that NKAIN2 was expressed at high mRNA levels in neuroblastoma patients and detected in MYCN-amplified neuroblastoma cell lines, suggesting a potential oncogenic role in neuronal contexts . In contrast, NKAIN2 appears to act as a tumor suppressor in prostate cancer and other tissues .

What bioinformatic approaches should be used for analyzing bovine NKAIN2 sequence conservation and structural predictions?

For comprehensive bioinformatic analysis of bovine NKAIN2, implement the following methodological framework:

  • Evolutionary Conservation Analysis:

    • Use tools like ConSurf to map conservation scores onto protein structure

    • Perform multiple sequence alignment across species to identify highly conserved regions

    • Generate phylogenetic trees to understand evolutionary relationships of NKAIN proteins

  • Structural Domain Analysis:

    • Identify functional domains using Pfam, SMART, and InterPro databases

    • Focus on the DUF798 domain characteristic of NKAIN family members

    • Analyze transmembrane domains using TMHMM, Phobius, or TOPCONS

  • Protein-Protein Interaction Prediction:

    • Use tools like STRING, PSICQUIC, and IntAct to predict interaction partners

    • Focus on Na+/K+-ATPase β1 subunit interactions

    • Identify potential binding motifs and interfaces

  • Molecular Dynamics Simulations:

    • Build 3D models using homology modeling or ab initio prediction methods

    • Perform molecular dynamics simulations to understand protein flexibility and stability

    • Analyze potential conformational changes upon binding to interaction partners

When analyzing sequence conservation, note that NKAIN genes show striking evolutionary conservation among species, particularly in the first two transmembrane domains from Drosophila to human . This high conservation suggests functional significance in these regions. For bovine NKAIN2, compare with the human sequence (UniProt ID: Q5VXU1) to identify potential functional differences .

What considerations are important when designing antibodies for detecting recombinant bovine NKAIN2?

Designing effective antibodies for bovine NKAIN2 requires careful consideration of several methodological factors:

  • Epitope Selection:

    • Choose epitopes unique to NKAIN2 (avoid regions with similarity to other NKAIN family members)

    • Target regions that are:

      • Highly antigenic (use tools like BepiPred, ABCpred)

      • Surface-exposed (based on structural predictions)

      • Conserved between bovine and model species (if using for cross-species studies)

      • Outside the transmembrane domains (for better accessibility)

  • Antibody Format Selection:

    • Polyclonal antibodies: Provide broader epitope recognition but may have batch-to-batch variation

    • Monoclonal antibodies: Offer high specificity and consistency but may have limited epitope recognition

    • Recombinant antibodies: Allow for precise engineering but may require more development

  • Validation Strategy:

    • Test antibody against:

      • Purified recombinant bovine NKAIN2

      • Positive control tissues (based on expression data)

      • Negative control tissues (with no NKAIN2 expression)

      • NKAIN2 knockout or knockdown samples

    • Perform cross-reactivity tests with other NKAIN family members

  • Application-Specific Considerations:

    • For Western blotting: Target linear epitopes

    • For immunoprecipitation: Target surface-exposed regions

    • For immunohistochemistry: Consider fixation effects on epitope accessibility

When designing antibodies, note that bovine NKAIN2 is expected to be primarily expressed in nervous system tissues, similar to human NKAIN2 . The protein contains multiple transmembrane domains, so careful epitope selection is crucial for generating antibodies that can recognize the native protein in different experimental contexts.

How can researchers effectively quantify protein-protein interactions between bovine NKAIN2 and Na⁺/K⁺-ATPase?

To quantitatively characterize the interaction between bovine NKAIN2 and Na⁺/K⁺-ATPase, implement these methodological approaches:

  • Microscale Thermophoresis (MST):

    • Label one protein (preferably the smaller one) with a fluorescent dye

    • Prepare serial dilutions of the unlabeled binding partner

    • Measure changes in thermophoretic mobility upon binding

    • Calculate binding constants (KD) from concentration-dependent changes

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure thermodynamic parameters of binding

    • Determine:

      • Binding affinity (KD)

      • Binding stoichiometry (n)

      • Enthalpy changes (ΔH)

      • Entropy changes (ΔS)

    • No labeling required, providing label-free quantification

  • Bio-Layer Interferometry (BLI):

    • Immobilize one protein on a biosensor tip

    • Measure real-time binding of the interaction partner

    • Determine association and dissociation rates

    • Calculate affinity constants from kinetic data

  • Quantitative FRET Analysis:

    • Create fusion constructs with appropriate fluorophore pairs

    • Measure FRET efficiency at various concentration ratios

    • Apply mathematical models to extract binding parameters

    • Particularly useful for membrane protein interactions

  • Data Analysis and Validation:

    • Fit binding data to appropriate models (1:1 binding, cooperative binding, etc.)

    • Use global fitting across multiple experiments to improve parameter estimation

    • Validate results using multiple independent methods

    • Test effects of mutations at predicted interaction interfaces

These quantitative approaches provide comprehensive characterization of protein-protein interactions, offering insights into the strength, kinetics, and thermodynamics of the bovine NKAIN2 interaction with Na⁺/K⁺-ATPase.

What are the major challenges in studying bovine NKAIN2 and how can they be addressed?

Researchers face several significant challenges when studying bovine NKAIN2:

  • Protein Expression and Purification:

    • Challenge: NKAIN2 is a transmembrane protein, which typically presents difficulties in expression and purification

    • Solution:

      • Use specialized detergents for extraction

      • Consider nanodiscs or styrene maleic acid lipid particles (SMALPs) for membrane protein studies

      • Explore insect cell or mammalian expression systems for proper folding and post-translational modifications

  • Limited Available Resources:

    • Challenge: Few validated reagents specific for bovine NKAIN2 are commercially available

    • Solution:

      • Generate custom antibodies using recombinant proteins as immunogens

      • Validate commercial antibodies raised against human NKAIN2 for cross-reactivity

      • Develop bovine-specific molecular tools (plasmids, CRISPR guides, etc.)

  • Complex Isoform Pattern:

    • Challenge: Four main splice variants with potentially different functions

    • Solution:

      • Use isoform-specific primers for PCR and qPCR

      • Generate constructs for individual isoforms

      • Develop isoform-specific antibodies when possible

  • Tissue-Specific Expression:

    • Challenge: Primarily expressed in neuronal tissues, which can be difficult to obtain and work with

    • Solution:

      • Establish collaborations with veterinary schools for tissue access

      • Consider organoid models to recapitulate tissue-specific environments

      • Use conditional expression systems in heterologous cell lines

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and computational methods.

What emerging technologies might advance our understanding of bovine NKAIN2 function?

Several cutting-edge technologies hold promise for advancing NKAIN2 research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Application: Determine high-resolution structures of NKAIN2 alone and in complex with Na+/K+-ATPase

    • Advantage: Works well for membrane proteins without crystallization

    • Expected insight: Molecular details of NKAIN2-Na+/K+-ATPase interaction interface

  • Single-Cell RNA Sequencing (scRNA-seq):

    • Application: Profile NKAIN2 expression across different cell types in bovine tissues

    • Advantage: Reveals cell-type specific expression patterns not detectable in bulk analysis

    • Expected insight: Identification of specific neuronal populations expressing NKAIN2

  • CRISPR-Cas9 Genome Editing:

    • Application: Create precise modifications in the bovine NKAIN2 gene

    • Advantage: Generate knockout, knockin, and point mutations in relevant cell lines

    • Expected insight: Functional consequences of NKAIN2 loss or mutation

  • Proximity Labeling (BioID, APEX):

    • Application: Identify proteins that interact with NKAIN2 in living cells

    • Advantage: Captures weak or transient interactions in native cellular environment

    • Expected insight: Comprehensive NKAIN2 interactome beyond Na+/K+-ATPase

  • Organoids and Organ-on-a-Chip:

    • Application: Study NKAIN2 function in more physiologically relevant contexts

    • Advantage: Recapitulates tissue architecture and cellular heterogeneity

    • Expected insight: Role of NKAIN2 in complex tissue environments

These technologies, especially when used in combination, can provide unprecedented insights into bovine NKAIN2 structure, function, interaction partners, and tissue-specific roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.