Recombinant Bovine Solute carrier family 25 member 33 (SLC25A33)

Shipped with Ice Packs
In Stock

Description

Introduction to SLC25A33

SLC25A33 belongs to the solute carrier family 25 (SLC25), a group of mitochondrial carriers responsible for transporting nucleotides, amino acids, and cofactors . In bovines, recombinant SLC25A33 is engineered to study its role in mitochondrial metabolism, particularly in pyrimidine nucleotide transport, which supports mitochondrial DNA (mtDNA) and RNA synthesis .

Production and Purification of Recombinant Bovine SLC25A33

Recombinant bovine SLC25A33 is produced using heterologous expression systems to ensure high yield and purity:

ParameterDetails
Host SystemsEscherichia coli, yeast, baculovirus, or mammalian cells .
Purity≥85% (verified via SDS-PAGE) .
ImmunogenRecombinant fragment protein spanning residues 100 to C-terminus .

This recombinant protein retains functional properties comparable to native mitochondrial carriers, enabling in vitro transport assays .

Substrate Specificity

Recombinant SLC25A33 transports pyrimidine (deoxy)nucleotides with distinct preferences:

SubstratesTransport MechanismKinetic Efficiency
Uracil, thymine, cytosine (deoxy)nucleoside di-/triphosphatesAntiportHigh affinity
Guanine nucleotidesAntiportModerate affinity
Adenine nucleotidesNot transportedN/A

Data derived from reconstituted liposome assays .

Inhibitors

  • Mercurial compounds (e.g., mersalyl) inhibit transport activity .

  • Sulfobetaines and pyridoxal 5'-phosphate (PLP) reduce substrate binding .

Functional Role in Mitochondrial Metabolism

SLC25A33 facilitates:

  • mtDNA Synthesis: Supplies deoxyribonucleotide triphosphates (dNTPs) for replication .

  • RNA Transcription: Imports pyrimidine ribonucleotides for mitochondrial RNA polymerization .

  • Nucleotide Salvage: Exports degraded nucleotides (e.g., UDP, CDP) to the cytosol .

In bovine models, its activity is critical for maintaining mitochondrial membrane potential and respiratory chain efficiency .

Key Studies

  1. Yeast Complementation: Expression of recombinant bovine SLC25A33 rescues Saccharomyces cerevisiae lacking RIM2 (yeast pyrimidine carrier), restoring mtDNA stability .

  2. Cell Proliferation: Overexpression in bovine cells enhances mitochondrial nucleotide pools, reducing reactive oxygen species (ROS) and promoting oxidative phosphorylation .

Comparative Analysis with Human SLC25A33

FeatureBovine SLC25A33Human SLC25A33
Amino Acid Length321 residues (partial) 298 residues
Tissue ExpressionUbiquitous (unpublished)Liver, pancreas, muscle
Functional OverlapPyrimidine transportIdentical substrate profile

Future Directions

  • Structural Studies: Cryo-EM analysis to resolve transport mechanisms.

  • Therapeutic Targeting: Explore inhibitors for cancer or metabolic disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A33; Solute carrier family 25 member 33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SLC25A33
Target Protein Sequence
MATGTQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTIS GAGVVRQTSVTPGLLQVLKSILEKEGPRSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFN GVFVPNSNIVHVFSAGSAAFVTNSLMNPIWMVKTRMQLERKVRGSKQMNTLQCARYVYQT EGIRGFYRGLTASYAGISETIICFAIYESLKKYLKEAPLASSTNGTEKNSTNFFGLMAAA ALSKGCASCVAYPHEVIRTRLREEGSKYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIP NTAIVLSTYELIVYLLEDHAQ
Uniprot No.

Target Background

Function
SLC25A33, also known as Recombinant Bovine Solute carrier family 25 member 33, is a mitochondrial transporter responsible for importing and exporting pyrimidine nucleotides into and from mitochondria. It preferentially transports uracil, thymine, and cytosine (deoxy)nucleoside di- and triphosphates through an antiport mechanism. While also transporting guanine, it does not transport adenine (deoxy)nucleotides. The activity of SLC25A33 is significantly inhibited by pyridoxal 5'-phosphate, 4,7-diphenyl-1,10-phenanthroline, tannic acid, and mercurials (mercury dichloride, mersalyl acid, p-hydroxymercuribenzoate). This protein plays a crucial role in mitochondrial genome maintenance, regulation of mitochondrial membrane potential, and mitochondrial respiration. Upon stimulation by insulin (INS) or insulin-like growth factor 1 (IGF1), SLC25A33 regulates cell growth and proliferation by controlling mitochondrial DNA replication and transcription, as well as the ratio of mitochondria-to nuclear-encoded components of the electron transport chain, ultimately influencing mitochondrial reactive oxygen species (ROS) production. Furthermore, SLC25A33 participates in dendritic cell endocytosis and may associate with mitochondrial oxidative phosphorylation.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A33 and what is its primary function in mitochondria?

SLC25A33 is a mitochondrial carrier protein that functions as a specialized transporter for pyrimidine nucleotides across the inner mitochondrial membrane. It primarily mediates the import and export of pyrimidine nucleotides (uracil, thymine, and cytosine) in their di- and triphosphate forms through an antiport mechanism . This transport activity is critical for maintaining the nucleotide pool balance between mitochondrial and cytosolic compartments. SLC25A33 selectively transports uridine, thymidine, guanosine, cytosine, and inosine (deoxy)nucleoside di- and triphosphates, but notably does not transport adenine nucleotides . The protein may specifically import (deoxy)nucleoside triphosphates in exchange for intramitochondrial (deoxy)nucleoside diphosphates, thus providing essential precursors for de novo synthesis of mitochondrial DNA and RNA while simultaneously exporting products of their catabolism .

How does SLC25A33 contribute to mitochondrial genome maintenance?

SLC25A33 plays a crucial role in mitochondrial genome maintenance through its regulation of nucleotide transport. By ensuring adequate supply of pyrimidine nucleotides to the mitochondrial matrix, SLC25A33 supports mtDNA replication and transcription processes . Research has demonstrated that depletion of SLC25A33 leads to reduction in mitochondrial nucleotide levels, particularly UTP, and subsequent depletion of mitochondrial DNA . Conversely, overexpression of SLC25A33 has been associated with enhanced mitochondrial DNA maintenance and increased mitochondrial TTP levels . The transporter also participates in regulation of mitochondrial membrane potential and mitochondrial respiration, which are intricately connected to mtDNA integrity . Experimental evidence indicates that cellular pyrimidine imbalance can trigger mitochondrial DNA release, which requires SLC25A33 activity, suggesting its involvement in the mitochondrial response to metabolic stress .

What are the known regulatory mechanisms of SLC25A33 expression?

SLC25A33 expression is regulated by multiple hormonal and environmental factors. Studies have demonstrated that 17β-estradiol increases SLC25A33 mRNA expression, while co-treatment with TGFB1 protein results in decreased expression . Similarly, dihydrotestosterone (17β-hydroxy-5α-androstan-3-one) has been found to increase SLC25A33 expression . Environmental toxins such as 2,3,7,8-tetrachlorodibenzodioxine can both increase and decrease SLC25A33 expression depending on the experimental context and specific cell types . The protein is also regulated at the post-translational level, with evidence suggesting that SLC25A33 can be a substrate for mitochondrial proteases such as YME1L . Upon insulin (INS) or insulin-like growth factor 1 (IGF1) stimulation, SLC25A33 participates in regulating cell growth and proliferation by controlling mitochondrial DNA replication and transcription, which affects the ratio of mitochondria-to-nuclear-encoded components of the electron transport chain .

How can recombinant bovine SLC25A33 be effectively produced and purified for research purposes?

The production of recombinant bovine SLC25A33 typically involves bacterial expression systems, particularly Escherichia coli, followed by protein purification and reconstitution into liposomes for functional studies . The methodology involves several key steps:

  • Cloning and Expression Vector Design: The SLC25A33 coding sequence should be optimized for bacterial expression and cloned into a suitable expression vector containing an inducible promoter (typically T7) and appropriate affinity tags (His-tag or GST-tag) for purification.

  • Bacterial Transformation and Culture: The expression vector is transformed into an E. coli strain optimized for membrane protein expression (e.g., C41(DE3) or BL21(DE3)pLysS). Cultures are grown to mid-log phase before induction with IPTG under optimized conditions (typically 18-25°C for 16-24 hours to reduce inclusion body formation).

  • Membrane Fraction Isolation: Bacterial cells are harvested and lysed using mechanical disruption methods such as sonication or high-pressure homogenization. The membrane fraction containing the recombinant SLC25A33 is isolated by differential centrifugation.

  • Detergent Solubilization: The membrane proteins are solubilized using carefully selected detergents that maintain protein functionality. Common choices include n-dodecyl-β-D-maltoside (DDM) or digitonin.

  • Affinity Chromatography: The solubilized protein is purified using affinity chromatography based on the incorporated tag. This is typically followed by size exclusion chromatography to enhance purity.

  • Reconstitution into Liposomes: For functional studies, the purified SLC25A33 is reconstituted into liposomes by mixing with phospholipids and removing the detergent through dialysis or adsorbent beads .

The quality and functionality of the recombinant protein can be assessed through SDS-PAGE, Western blotting with specific antibodies, and transport assays using radiolabeled nucleotides to confirm carrier activity .

What methodologies are most effective for studying SLC25A33-mediated nucleotide transport?

Studying SLC25A33-mediated nucleotide transport requires specialized techniques that can accurately measure the movement of nucleotides across membranes. The following methodologies have proven most effective:

  • Liposome Reconstitution Assays: The gold standard method involves reconstituting purified SLC25A33 into liposomes and measuring the uptake or exchange of radiolabeled nucleotides . This system allows for precise control of internal and external substrate concentrations and can define transport kinetics (Km and Vmax values).

  • Isolated Mitochondria Transport Assays: Mitochondria isolated from cells expressing normal or altered levels of SLC25A33 can be used to measure nucleotide uptake using radiolabeled substrates.

  • Nucleotide Pool Analysis: Liquid chromatography-mass spectrometry (LC-MS) can be employed to quantify changes in mitochondrial and cytosolic nucleotide pools in response to SLC25A33 manipulation.

  • Patch-Clamp Electrophysiology: For detailed biophysical characterization, patch-clamp techniques can be applied to mitoplasts (mitochondria with the outer membrane removed) to measure SLC25A33-mediated currents.

  • Fluorescent Nucleotide Analogs: Using fluorescently labeled nucleotide analogs can allow real-time visualization of transport in living cells using confocal microscopy.

  • Transport Inhibition Studies: Transport assays in the presence of specific inhibitors of mitochondrial carriers (such as mercurial compounds) can help characterize the transport mechanism .

These methodologies have revealed that SLC25A33 transports uracil, thymine, and cytosine (deoxy)nucleotides with different efficiencies and primarily operates through an antiport mechanism, exchanging external nucleoside triphosphates for internal nucleoside diphosphates .

How does SLC25A33 contribute to immune signaling, and what experimental approaches can detect this activity?

SLC25A33 has been implicated in immune signaling through its role in mitochondrial DNA (mtDNA) release and subsequent activation of the cGAS-STING-TBK1 inflammatory pathway . This immune signaling function of SLC25A33 can be investigated using the following experimental approaches:

  • Cytosolic mtDNA Detection:

    • qPCR analysis of cytosolic fractions to quantify mtDNA release

    • Immunofluorescence microscopy with DNA-specific dyes and mitochondrial markers to visualize mtDNA localization

    • PicoGreen staining of non-nuclear DNA combined with mitochondrial markers

  • Immune Signaling Pathway Analysis:

    • Western blotting for phosphorylated STING, TBK1, and IRF3

    • Luciferase reporter assays for IFN-β promoter activity

    • qRT-PCR for interferon-stimulated genes (ISGs)

    • ELISA measurements of type I interferons in cell culture supernatants

  • Genetic Manipulation Approaches:

    • SLC25A33 overexpression systems to induce immune signaling

    • CRISPR-Cas9 knockout or siRNA-mediated knockdown of SLC25A33

    • Rescue experiments in SLC25A33-depleted cells

    • Mutagenesis of critical transport residues to separate transport function from immune activity

  • Metabolic Modulation:

    • Inhibition of de novo pyrimidine synthesis to induce pyrimidine deficiency

    • Nucleotide supplementation experiments to rescue phenotypes

    • Measurement of cellular pyrimidine pools using HPLC or LC-MS/MS

Research has demonstrated that overexpression of SLC25A33 is sufficient to induce immune signaling mediated by mtDNA, while cellular responses to pyrimidine deficiency require functional SLC25A33 to trigger mtDNA-dependent immune activation .

What techniques are recommended for studying SLC25A33 interactions with mitochondrial proteases?

Evidence suggests that SLC25A33 may be regulated by mitochondrial proteases such as YME1L . Investigating these interactions requires specialized approaches:

  • Protein Stability Assays:

    • Cycloheximide chase experiments can reveal the degradation kinetics of SLC25A33 in cells with normal or depleted protease levels

    • Pulse-chase labeling with 35S-methionine to track protein turnover rates

  • Protease-Substrate Co-Immunoprecipitation:

    • Pull-down assays using tagged versions of SLC25A33 and potential protease partners

    • Proximity labeling techniques such as BioID or APEX2 to identify proteins in close proximity to SLC25A33

  • In Vitro Degradation Assays:

    • Purified components can be combined to test direct degradation of SLC25A33 by specific proteases

    • Time-course analysis of degradation products by SDS-PAGE and Western blotting

  • Structural Analysis of Recognition Sites:

    • Mutagenesis of potential protease recognition sites in SLC25A33

    • Hydrogen-deuterium exchange mass spectrometry to identify regions of SLC25A33 accessible to proteases

  • Mitochondrial Membrane Protein Complex Analysis:

    • Blue native PAGE to preserve membrane protein complexes

    • Complexome profiling combining native electrophoresis with mass spectrometry

Research using cycloheximide chase experiments has demonstrated increased stability of SLC25A33 in YME1L-deficient cells, suggesting it may be a substrate for this mitochondrial protease .

How can researchers assess the impact of SLC25A33 activity on mitochondrial function?

The impact of SLC25A33 on mitochondrial function can be comprehensively assessed using these methodological approaches:

  • Mitochondrial Respiration Analysis:

    • Oxygen consumption rate (OCR) measurements using Seahorse XF analyzers

    • High-resolution respirometry with Oroboros instruments

    • Clark-type oxygen electrode measurements of isolated mitochondria

  • Mitochondrial Membrane Potential:

    • Fluorescent probes such as TMRM, JC-1, or Rhodamine 123

    • Flow cytometry or confocal microscopy-based quantification

  • Mitochondrial DNA Analysis:

    • qPCR to quantify mtDNA copy number

    • Long-range PCR to detect mtDNA deletions

    • Next-generation sequencing for comprehensive mtDNA integrity assessment

    • Fluorescence in situ hybridization for mtDNA visualization

  • Reactive Oxygen Species Measurement:

    • Mitochondria-specific probes like MitoSOX Red

    • General ROS indicators such as DCF-DA

    • Electron paramagnetic resonance spectroscopy for specific radical detection

  • Mitochondrial Protein Synthesis:

    • 35S-methionine labeling of newly synthesized mitochondrial proteins

    • Northern blotting or qRT-PCR for mitochondrial RNA levels

    • Ribosome profiling to assess translation efficiency

Research has shown that SLC25A33 knockdown leads to depletion of mtDNA, reduced oxidative phosphorylation, decreased cell size, lower mitochondrial UTP levels, and increased reactive oxygen species, while its overexpression enhances cell size, increases mitochondrial TTP levels, and diminishes reactive oxygen species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.