Recombinant Bovine Solute carrier family 25 member 38 (SLC25A38)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize development of your specified tag.
Synonyms
SLC25A38; Mitochondrial glycine transporter; Solute carrier family 25 member 38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SLC25A38
Target Protein Sequence
MIQKSRPALLQHQDVGDRVETLMLQPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQP SAHGSRRVGMLALLLNVVRTESPLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLRGHP PTALESIILGAGSRSVAGVCMSPITVIKTRYESGRYGYESVYAALRSICHSEGFRGLFSG LTATLLRDAPFSGIYLMFYSQTKNVVLHRTDQLDAVLVPVVNFSCGIFAGILASLVTQPA DVIKTHMQLFPMKFRWIGQSVTLIFKDYGLRGFFQGSVPRALRRTLMAAMAWTVYEEMMA KMGLKS
Uniprot No.

Target Background

Function
Recombinant Bovine Solute carrier family 25 member 38 (SLC25A38) is a mitochondrial glycine transporter responsible for importing glycine into the mitochondrial matrix. It plays a crucial role in providing glycine for the initial enzymatic step in heme biosynthesis, the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) within the mitochondrial matrix. This process is essential during erythropoiesis.
Database Links

KEGG: bta:512325

STRING: 9913.ENSBTAP00000045521

UniGene: Bt.6425

Protein Families
Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of bovine SLC25A38 in cellular metabolism?

Bovine SLC25A38, like its human counterpart, functions as a mitochondrial glycine transporter that imports glycine into the mitochondrial matrix. It plays a crucial role in heme biosynthesis by providing glycine for the first enzymatic step of this pathway, where glycine condenses with succinyl-CoA to produce 5-aminolevulinate (ALA) in the mitochondrial matrix . This reaction is catalyzed by ALA synthase and represents the rate-limiting step in heme synthesis. Additionally, SLC25A38 is required during erythropoiesis, the process of red blood cell formation . Recent research has also identified SLC25A38 as playing a role as a pro-apoptotic protein capable of inducing caspase-dependent apoptosis .

What experimental methods are most effective for confirming the subcellular localization of SLC25A38?

To confirm the mitochondrial localization of SLC25A38, researchers should employ multiple complementary approaches:

  • Cell fractionation and Western blotting: This method involves separating cytosolic and mitochondrial fractions by differential centrifugation, followed by Western blot analysis to detect SLC25A38 in isolated fractions. This approach has successfully demonstrated that SLC25A38 is primarily present in the mitochondrial fraction in human cells .

  • Immunofluorescence microscopy: This technique uses specific antibodies against SLC25A38 along with mitochondrial markers (such as MitoTracker) to visualize the protein's localization within cells. Research has shown that immunofluorescence imaging clearly highlights the distinct localization of SLC25A38 within mitochondria .

  • Protein tagging and live-cell imaging: Expressing SLC25A38 with fluorescent protein tags (such as GFP) allows for real-time visualization of its localization and dynamics in living cells.

The combination of these approaches provides robust evidence for mitochondrial localization, as demonstrated in studies of human SLC25A38 .

What are the most reliable expression systems for producing recombinant bovine SLC25A38?

Based on the available data, several expression systems can be considered for producing recombinant SLC25A38:

  • Wheat germ cell-free expression system: This system has been successfully used to produce full-length human SLC25A38 (1-304 aa) suitable for both ELISA and Western blot applications . This approach may be particularly valuable for bovine SLC25A38 expression as it allows for the production of properly folded membrane proteins.

  • Yeast expression systems: Saccharomyces cerevisiae has been utilized effectively to express human SLC25A38, demonstrating functional complementation in yeast cells lacking the endogenous homolog Hem25 . This system is advantageous because it provides a eukaryotic environment with appropriate post-translational modifications.

  • Mammalian cell expression: HEK293T cells have been used to express both endogenous and FLAG-tagged SLC25A38 for functional studies , suggesting this system could be adapted for bovine protein expression.

The choice between these systems should be guided by the specific experimental requirements, considering factors such as protein yield, post-translational modifications, and functional activity.

How does the protein turnover rate of SLC25A38 impact experimental design for functional studies?

Recent research has revealed that SLC25A38 is a short-lived mitochondrial transporter with a half-life of approximately 4 hours, significantly shorter than the median half-life of several days for most mitochondrial carriers in mammalian cells . This rapid turnover rate has profound implications for experimental design:

ProteinHalf-lifeRelative Stability
SLC25A38~4 hoursShort-lived
SLC25A51 (NAD+ transporter)>8 hoursRelatively stable
Typical mitochondrial carriersSeveral daysVery stable

When designing experiments involving SLC25A38:

  • Pulse-chase experiments: Should be designed with shorter time intervals (1-2 hours) to accurately capture the rapid degradation kinetics.

  • Protein synthesis inhibition: When using cycloheximide (CHX) or other protein synthesis inhibitors, researchers must account for the rapid disappearance of SLC25A38, potentially masking treatment effects if observation times are too long .

  • Stabilizing interventions: Experiments might require proteasome inhibitors or other stabilizing agents to maintain sufficient protein levels during longer-term experiments.

  • Timing of observations: Critical observations should be made within the protein's half-life window to ensure meaningful data collection before significant degradation occurs.

The rapid turnover of SLC25A38 appears to be specific to this transporter and not due to general destabilization of mitochondrial transporters, suggesting unique regulatory mechanisms that may themselves be worthy of investigation .

What methodological approaches are most effective for investigating the glycine transport function of bovine SLC25A38?

To investigate the glycine transport function of bovine SLC25A38, researchers should consider the following methodological approaches:

  • Complementation studies in yeast models: Utilizing yeast strains with inactivated HEM25 (the yeast homolog of SLC25A38) has proven effective for functional analysis. The ability of bovine SLC25A38 to restore heme levels in hem25Δ yeast cells would provide strong evidence for conserved glycine transport function .

  • Growth assays using glycine as sole nitrogen source: This approach takes advantage of yeast cells' ability to use glycine as their sole nitrogen source, which requires efficient mitochondrial glycine import for conversion to NH₃ by the glycine cleavage system. Impaired growth of hem25Δ cells on glycine-only media has been demonstrated, providing a functional readout for glycine transport capacity .

  • Direct transport assays using isolated mitochondria: This involves:

    • Isolating intact mitochondria from cells expressing bovine SLC25A38

    • Measuring the uptake of radiolabeled glycine (¹⁴C-glycine) into these mitochondria

    • Comparing transport kinetics with appropriate controls (mitochondria lacking SLC25A38)

  • Metabolite profiling: Measuring 5-aminolevulinic acid (5-ALA) and other heme precursors in cells expressing bovine SLC25A38 versus controls can provide indirect evidence of glycine transport function, as these metabolites depend on mitochondrial glycine availability .

These complementary approaches would establish whether bovine SLC25A38 functions similarly to the human protein as a mitochondrial glycine transporter essential for heme biosynthesis.

What are the key considerations when designing mutation studies to investigate structure-function relationships in bovine SLC25A38?

When designing mutation studies for bovine SLC25A38, researchers should consider:

A systematic mutation analysis focusing on these considerations would provide valuable insights into the structural determinants of bovine SLC25A38 function and potentially reveal species-specific features.

How can researchers effectively differentiate between the effects of SLC25A38 and secondary mitochondrial glycine transporters in functional studies?

Research has indicated that SLC25A38 (Hem25 in yeast) is not the sole mitochondrial glycine importer . To effectively differentiate between SLC25A38 and secondary transporters:

  • Gene knockout/knockdown strategies:

    • Generate single knockouts of SLC25A38 and candidate secondary transporters (such as the YMC1 homolog in bovine cells)

    • Create double/multiple knockouts to assess synergistic effects

    • Use inducible knockdown systems to control the timing and extent of transporter depletion

  • Pharmacological approaches:

    • Identify and apply selective inhibitors of different transporter classes

    • Use competition assays with different substrates to distinguish transporter specificities

  • Kinetic analysis:

    • Perform detailed kinetic studies (Km, Vmax) for glycine transport in the presence and absence of SLC25A38

    • Analyze transport under different conditions (pH, membrane potential) that may differentially affect distinct transporters

  • Metabolic flux analysis:

    • Trace isotope-labeled glycine to quantify its incorporation into different metabolic pathways

    • Compare flux distributions between wild-type and SLC25A38-deficient cells

  • Compensatory mechanism assessment:

    • Analyze expression changes in other transporters following SLC25A38 manipulation

    • Determine whether secondary transporters can restore function when SLC25A38 is absent

This multi-faceted approach would help delineate the specific contribution of SLC25A38 versus other transporters to mitochondrial glycine import and downstream metabolic processes.

What experimental approaches can identify potential post-translational modifications regulating bovine SLC25A38 activity?

To identify and characterize post-translational modifications (PTMs) of bovine SLC25A38:

  • Mass spectrometry-based proteomics:

    • Immunoprecipitate SLC25A38 from bovine cells/tissues

    • Perform liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Use enrichment techniques specific for different modifications (phosphopeptide enrichment, ubiquitin remnant profiling)

    • Compare PTM profiles under different physiological conditions

  • Site-directed mutagenesis:

    • Identify potential modification sites through bioinformatic prediction

    • Generate mutants (e.g., phosphomimetic mutations: S→D/E; phosphodeficient: S→A)

    • Test these mutants for altered stability, localization, and transport activity

  • Half-life and degradation pathway analysis:

    • Given the short half-life of SLC25A38 (~4 hours) , investigate proteasome and mitochondrial protease dependence

    • Test whether specific PTMs alter protein turnover rates

    • Examine potential regulation by the iAAA-mitochondrial protease YME1L1, which has been identified as regulating SLC25A38 turnover

  • Interaction studies:

    • Identify kinases, phosphatases, or other modification enzymes that interact with SLC25A38

    • Confirm these interactions through co-immunoprecipitation and proximity labeling techniques

  • Functional correlation:

    • Correlate identified PTMs with transport activity measurements

    • Determine if modifications change in response to altered cellular demands for heme synthesis

These approaches would provide insights into how bovine SLC25A38 activity may be dynamically regulated through post-translational modifications.

How might bovine SLC25A38 research inform potential treatments for human congenital sideroblastic anemia?

Research on bovine SLC25A38 could inform human therapeutics through several pathways:

  • Comparative functional analysis: Studying the bovine SLC25A38 may reveal species-specific differences in glycine transport efficiency or regulation that could inspire novel therapeutic approaches. Identification of regions with enhanced stability or activity in the bovine protein could guide protein engineering efforts for human applications.

  • Glycine and folate supplementation strategies: Research has shown that combining glycine with folate can restore hemoglobin levels in zebrafish models of SLC25A38-related congenital sideroblastic anemia (CSA) . Bovine models could help optimize these supplementation protocols:

TreatmentEffect in YeastEffect in ZebrafishPotential Clinical Relevance
Glycine aloneRestored heme levelsNo significant improvementInsufficient for human therapy
5-ALA aloneRestored heme levelsNo significant improvementInsufficient for human therapy
Glycine + FolateNot testedRestored hemoglobin levelsPromising therapeutic approach
  • Bypass strategies: Studies in yeast have shown that providing 5-aminolevulinic acid (5-ALA), a metabolite downstream of the glycine-dependent step in heme biosynthesis, can restore heme levels . Comparative studies using bovine SLC25A38 models could help determine optimal bypass compounds and dosing.

  • Alternative transport mechanisms: Identifying secondary glycine transporters in bovine mitochondria (similar to the yeast Ymc1 protein) could reveal potential compensatory pathways that might be therapeutically enhanced in humans with SLC25A38 mutations .

This translational research approach could provide alternatives to the current treatment for SLC25A38 CSA, which involves chronic blood transfusion coupled with iron chelation .

What methodological approaches are most effective for screening compounds that might stabilize mutant SLC25A38 proteins?

Given that SLC25A38 is rapidly degraded under physiological conditions , developing screens for stabilizing compounds could be valuable. Effective screening methodologies include:

  • Cell-based stability assays:

    • Engineer cell lines expressing fluorescently-tagged wild-type and mutant bovine SLC25A38

    • Monitor fluorescence intensity over time in the presence of test compounds

    • Identify compounds that increase fluorescence retention, indicating stabilized protein

  • Cycloheximide chase assays with high-throughput adaptation:

    • Use Western blotting to monitor SLC25A38 degradation in the presence of cycloheximide and test compounds

    • Quantify protein levels at multiple time points to calculate changes in half-life

    • Scale this approach to multi-well format for higher throughput

  • Thermal shift assays:

    • Assess the thermal stability of purified SLC25A38 in the presence of potential stabilizing compounds

    • Identify compounds that increase the melting temperature, indicating enhanced protein stability

  • Functional recovery screens:

    • Use yeast complementation systems where growth on glycine as a sole nitrogen source depends on functional SLC25A38/Hem25

    • Screen for compounds that restore growth of yeast expressing mutant SLC25A38

    • Confirm hits by measuring downstream metabolites like 5-ALA or heme

  • In silico screening followed by experimental validation:

    • Perform computational docking of compound libraries to structural models of SLC25A38

    • Prioritize compounds predicted to bind to and stabilize the protein

    • Validate top candidates using the experimental approaches above

These screening approaches could identify compounds that specifically stabilize SLC25A38, potentially leading to therapeutics for congenital sideroblastic anemia caused by destabilizing mutations.

What are the critical quality control parameters for validating recombinant bovine SLC25A38 preparations?

When producing and validating recombinant bovine SLC25A38, researchers should assess:

  • Protein purity and integrity:

    • SDS-PAGE analysis to confirm molecular weight (~33-35 kDa expected)

    • Western blotting with specific antibodies to verify identity

    • Mass spectrometry to confirm the full sequence and detect any truncations

  • Subcellular localization:

    • Fractionation studies to confirm mitochondrial enrichment

    • Immunofluorescence microscopy to visualize proper mitochondrial targeting

    • Protease protection assays to determine correct membrane topology

  • Functional activity:

    • Complementation assays in yeast hem25Δ strains to verify glycine transport function

    • Direct transport assays using reconstituted proteoliposomes or isolated mitochondria

    • Measurement of downstream metabolites (5-ALA, heme) in complementation systems

  • Structural integrity:

    • Circular dichroism spectroscopy to assess secondary structure content

    • Limited proteolysis to evaluate protein folding

    • Thermal stability assays to determine protein robustness

  • Post-translational modifications:

    • Phosphorylation state analysis

    • Ubiquitination assessment, particularly relevant given the protein's short half-life

    • Other modifications that might affect function or stability

Thorough validation using these parameters ensures that experimental results obtained with recombinant bovine SLC25A38 reliably reflect the protein's physiological properties.

How should researchers account for SLC25A38's rapid turnover when designing pulse-chase and metabolic labeling experiments?

The short half-life of SLC25A38 (~4 hours) necessitates specific adaptations for pulse-chase and metabolic labeling experiments:

  • Pulse duration optimization:

    • Use shorter pulse periods (15-30 minutes) to ensure adequate labeling before significant degradation

    • Consider higher concentrations of labeled precursors to achieve sufficient signal during brief pulses

  • Chase timeline adjustment:

    • Include early time points (0.5, 1, 2, 4 hours) to capture the rapid initial degradation phase

    • Extend measurements to 12-16 hours to fully characterize the degradation curve

    • Use logarithmic rather than linear time sampling to better capture exponential decay

  • Inhibitor studies design:

    • When using proteasome inhibitors or other compounds affecting protein stability, apply them for shorter durations to avoid secondary effects

    • Include appropriate controls (e.g., SLC25A51) with longer half-lives (>8 hours) to distinguish specific from general effects

  • Quantification methods:

    • Employ highly sensitive detection methods (phosphorimaging, fluorescence) to detect low-abundance labeled protein

    • Use internal normalization standards to account for technical variations

    • Consider mathematical modeling to accurately derive half-life values from nonlinear data

  • Fractionation considerations:

    • Perform subcellular fractionation immediately after labeling to minimize degradation during processing

    • Include protease inhibitors in all buffers to prevent artifactual degradation

These methodological adaptations will help researchers generate reliable data when studying this rapidly turned-over mitochondrial transporter.

How might transcriptional and post-translational regulation of SLC25A38 differ across tissues and physiological states?

Understanding the multi-level regulation of SLC25A38 across different contexts requires comprehensive analysis:

  • Tissue-specific expression patterns:

    • Perform quantitative analysis of SLC25A38 mRNA and protein levels across bovine tissues

    • Focus particularly on tissues with high heme requirements (bone marrow, liver, muscle)

    • Compare expression in developing versus mature tissues

  • Transcriptional regulatory mechanisms:

    • Identify transcription factors controlling SLC25A38 expression

    • Characterize the promoter region and potential enhancer elements

    • Investigate potential coordination with other heme biosynthesis genes

  • Post-translational regulation variations:

    • Compare SLC25A38 half-life across different tissues and cell types

    • Investigate tissue-specific differences in interaction with YME1L1, the iAAA-mitochondrial protease implicated in SLC25A38 turnover

    • Identify tissue-specific PTM patterns using proteomics approaches

  • Physiological state influences:

    • Analyze regulation during erythroid differentiation

    • Characterize responses to hypoxia, iron availability, and oxidative stress

    • Investigate changes during heightened heme demand (e.g., exercise, altitude adaptation)

  • Pathological condition impacts:

    • Examine regulatory changes in disease models affecting heme synthesis

    • Investigate compensatory regulation in response to deficiencies in other components of heme synthesis

This comprehensive analysis would provide insights into how SLC25A38 expression and activity are tailored to meet tissue-specific requirements under various physiological conditions.

What are the most promising approaches for investigating potential non-canonical functions of SLC25A38 beyond glycine transport?

While SLC25A38 is established as a mitochondrial glycine transporter, exploring potential additional functions requires innovative approaches:

  • Interactome analysis:

    • Perform proximity labeling (BioID, APEX) to identify proteins in close proximity to SLC25A38

    • Conduct co-immunoprecipitation with subsequent mass spectrometry to identify stable interactors

    • Use cross-linking approaches to capture transient interactions

  • Metabolomic profiling:

    • Compare metabolite profiles between wild-type and SLC25A38-deficient cells

    • Look beyond expected changes in glycine and heme pathway metabolites

    • Use stable isotope tracing to identify unexpected metabolic connections

  • Investigation of pro-apoptotic role:

    • Given SLC25A38's reported function as a pro-apoptotic protein that induces caspase-dependent apoptosis , explore:

    • The mechanisms linking glycine transport to apoptotic signaling

    • Potential direct interactions with apoptotic machinery

    • Conditions under which this function becomes predominant

  • Transport specificity assessment:

    • Test SLC25A38's ability to transport molecules structurally related to glycine

    • Investigate potential antiport mechanisms (what might be exchanged for glycine?)

    • Examine potential secondary transport functions activated under specific conditions

  • Systems biology approaches:

    • Integrate transcriptomic, proteomic, and metabolomic data from SLC25A38 manipulation studies

    • Apply network analysis to identify unexpected pathway connections

    • Generate and test hypotheses about non-canonical functions based on these connections

These approaches could reveal unexpected roles for SLC25A38 beyond its established function in glycine transport for heme biosynthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.