Recombinant Bovine Solute carrier family 25 member 48 (SLC25A48)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Metabolism

SLC25A48 is a mitochondrial choline importer essential for:

  • Betaine synthesis: Converts choline to betaine via mitochondrial oxidation .

  • One-carbon metabolism: Facilitates purine nucleotide synthesis by supplying one-carbon units .

  • Thermogenesis: Required for brown adipose tissue function and cold tolerance .

Key Research Findings

  • Choline Uptake: SLC25A48-KO cells show 7-fold reduced mitochondrial choline uptake and impaired betaine production .

  • Purine Nucleotide Deficiency: Loss of SLC25A48 disrupts G1-S phase transition due to inadequate adenine/guanine synthesis .

  • Disease Links: Rare variants in SLC25A48 correlate with musculoskeletal and digestive disorders in UK Biobank data .

Mechanistic Studies

  • Isotope Tracing: [1,2-¹³C₂]Choline experiments confirm SLC25A48’s role in mitochondrial betaine synthesis .

  • Mitochondrial Isolation: Radioactive [Methyl-³H]Choline assays validate transport activity in isolated mitochondria .

Therapeutic Implications

  • Cancer Metabolism: SLC25A48’s role in purine synthesis makes it a potential target for cancer therapies .

  • Metabolic Disorders: Dysregulation may contribute to choline/betaine deficiencies linked to liver or adipose tissue dysfunction .

Comparative Analysis with Human Ortholog

ParameterBovine SLC25A48 Human SLC25A48
UniProt IDQ3MHI3Q6ZT89
AA Sequence Identity~85% (aligned with human)Full-length (1–311aa)
Expression SystemE. coliE. coli
TagN-terminal HisN-terminal His

Both orthologs share structural homology and functional roles in mitochondrial choline import .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SLC25A48; Solute carrier family 25 member 48
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SLC25A48
Target Protein Sequence
MGNFQLEDFVAGWIGGAASVIVGHPLDTVKARLQAGSGYGSTLSCIRTVYRRESVFGFFK GMSFPLASIAVYNSVVFGVFSNTQRFLSHHRCQEPEAGPPHVLSDLLLASMVAGVVSVGL GAPVDLIEIRLQMQTQPFQEANLGLKPRVAALGEQPAYQGPVHCFATIVRTEGLAGLYRG ASAMLLRDVPGYCLYFIPYVFLSDWITPEACAGPSPCAVWLAGGMAGAISWGTATPMDVV KSRLQADGVYVNKYRGVLDCMSQSYQKEGLKVFFRGITVNAVRGFPMSAAMFLGYELSLQ AIRGDHVVTSP
Uniprot No.

Target Background

Database Links

KEGG: bta:515496

STRING: 9913.ENSBTAP00000032026

UniGene: Bt.6349

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A48 and what is its primary function?

SLC25A48 is a mitochondrial membrane transporter that belongs to the solute carrier family 25. Recent research has identified it as a mitochondrial choline transporter . This protein is highly expressed in brown adipose tissue (BAT), liver, and kidney, while its expression is nearly undetectable in heart and soleus muscle despite these tissues containing high levels of mitochondria . The primary function of SLC25A48 is to facilitate the transport of choline across the inner mitochondrial membrane, which is essential for mitochondrial choline metabolism and downstream synthesis of betaine .

What methodologies can be used to confirm SLC25A48 localization in mitochondria?

Several complementary approaches can be used to determine the subcellular localization of SLC25A48:

  • High-resolution immunofluorescence microscopy: Using tagged versions of SLC25A48 (e.g., SLC25A48-FLAG) co-stained with mitochondrial markers like TOM20 (outer mitochondrial membrane) and MTCO1 or ATP5A (inner mitochondrial membrane) .

  • Proteinase degradation assay: This technique uses isolated mitochondria treated with proteinase K to degrade outer mitochondrial membrane proteins while leaving inner membrane proteins intact. Presence of SLC25A48 after proteinase K treatment confirms inner mitochondrial membrane localization .

  • Super-resolution immunofluorescence microscopy: This technique provides higher precision in determining submitochondrial localization, as demonstrated in studies identifying SLC25A48 specifically in the inner mitochondrial membrane .

  • Co-localization analysis: Quantitative co-localization with established mitochondrial membrane markers can provide a co-localization index to confirm mitochondrial localization .

  • Subcellular fractionation: Isolating mitochondria and analyzing the presence of SLC25A48 in mitochondrial fractions compared to other cellular fractions .

How does SLC25A48 contribute to the one-carbon metabolic pathway?

SLC25A48 plays a crucial role in the one-carbon metabolic pathway through its function as a mitochondrial choline transporter:

  • Choline import: SLC25A48 facilitates the transport of choline into mitochondria, which is the first step in mitochondrial choline metabolism .

  • Betaine synthesis: Inside mitochondria, transported choline is oxidized to betaine aldehyde and then to betaine. Metabolomic analyses show significantly reduced levels of betaine aldehyde and betaine in SLC25A48-KO mitochondria compared to controls .

  • One-carbon cycle connection: Phylogenetic analysis revealed that adenosylhomocysteinase (AHCY), involved in the one-carbon methionine cycle, is the top co-evolved gene with SLC25A48 in humans. Gene ontology analysis of top co-evolved genes shows enrichment of the one-carbon cycle pathway .

  • Purine nucleotide synthesis: Through the folate cycle, choline-derived one-carbon units contribute to the synthesis of purine nucleotides. Metabolomic analyses show significantly reduced levels of purine nucleotides (adenine, AMP, dAMP, IMP, FAD) in SLC25A48-KO mitochondria .

The metabolic pathway can be summarized as:
Choline (transported by SLC25A48) → Betaine aldehyde → Betaine → Methyl groups → Folate cycle → Purine nucleotide synthesis

What experimental evidence demonstrates SLC25A48's role as a choline transporter?

Multiple lines of evidence support SLC25A48's function as a choline transporter:

  • GWAS studies: Genome-wide association studies identified SNPs in the SLC25A48 locus highly associated with plasma choline levels. The rs200164783 SNP was the most significant SNP (p = 2.3e–33) for choline across the genome .

  • Mitochondrial transport assays: Direct measurement of choline uptake into mitochondria shows significantly reduced choline transport in SLC25A48-KO or SNP-KI (rs200164783) cells compared to wild-type cells .

  • Metabolomics evidence: LC-MS metabolomics in whole cells and isolated mitochondria revealed reduced betaine (a choline metabolite) in SLC25A48-KO cells, with betaine being the most differentially abundant metabolite .

  • Rescue experiments: Exogenous betaine supplementation partially rescues phenotypes associated with SLC25A48 loss, particularly reducing elevated mitochondrial ROS levels in SNP-KI cells to levels equivalent to control cells .

  • Sex-specific associations: GWAS studies found that alleles in SLC25A48 (rs6596270) influence choline concentrations specifically in men (p = 9.6 × 10^-8), but not women, suggesting hormonal regulation of this transport system .

How does SLC25A48 deficiency affect mitochondrial function and cellular metabolism?

SLC25A48 deficiency leads to multiple functional consequences in mitochondria and cellular metabolism:

ParameterEffect of SLC25A48 DeficiencyExperimental Evidence
Mitochondrial morphologyEnlarged mitochondria with less dense cristaeElectron microscopy of BAT from SLC25A48-KO mice
Mitochondrial respirationSignificantly attenuated via Complex I and IIOxygen consumption rate measurements in isolated BAT mitochondria
ROS productionElevated H₂O₂ productionDirect measurement of mitochondrial H₂O₂ production (JH₂O₂)
Purine nucleotidesReduced levels (adenine, AMP, dAMP, IMP, FAD)LC-MS metabolomics of isolated mitochondria
NAD and NADPHSignificantly lower levelsLC-MS metabolomics of isolated mitochondria
TCA cycle metabolitesReduced fumarateLC-MS metabolomics
Cell proliferationSignificantly reducedEdU incorporation assays and cell growth assays
Cell cycleImpaired G1-to-S phase transitionCell cycle analysis

These findings demonstrate that SLC25A48 deficiency impairs mitochondrial function through multiple mechanisms, ultimately affecting cellular energy metabolism and proliferation.

What methods can be used to generate and validate SLC25A48 knockout models?

Several complementary approaches have been successfully used to generate and validate SLC25A48 knockout models:

  • Germline knockout mice:

    • Mice with a germline knockout (KO) of SLC25A48 lacking exon 4, which encoded two of the six transmembrane domains, have been developed .

    • Genotyping by PCR to confirm deletion of targeted exons .

    • Western blotting to confirm absence of SLC25A48 protein .

  • CRISPR-Cas9 cellular models:

    • CRISPR-Cas9 genome editing to delete portions of the SLC25A48 gene in cell lines .

    • Design of guide RNAs targeting specific exons with tools like CRISPOR, CRISPRdirect, and Benchling to select for highest on-target and lowest off-target scores .

    • Isolation of single-cell clones using flow cytometry sorting of transfected cells .

    • Validation by DNA sequencing to confirm targeted mutations .

  • SNP knockin models:

    • CRISPR-Cas9 with homology-directed repair (HDR) to introduce specific SNPs like rs200164783 (A>G) in human cells .

    • Concurrent mutation of the PAM site to eliminate continuous Cas9 activity while keeping amino acid sequence intact .

    • Validation by Sanger sequencing and functional assays .

  • Functional validation:

    • Choline transport assays to confirm reduced mitochondrial choline uptake .

    • Metabolomics to verify altered choline metabolites .

    • Mitochondrial respiration and ROS production measurements .

What are the key experimental considerations when working with recombinant SLC25A48 proteins?

When working with recombinant SLC25A48 proteins, researchers should consider several important factors:

  • Expression system selection:

    • E. coli systems are commonly used for recombinant SLC25A48 production .

    • Mammalian expression systems may be preferred for functional studies requiring proper folding and post-translational modifications .

  • Protein tagging strategy:

    • N-terminal His-tag is commonly used for purification purposes .

    • C-terminal FLAG-tag has been successfully used for localization studies .

    • Ensure tags do not interfere with protein function or localization.

  • Storage and handling:

    • Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use .

    • Avoid repeated freeze-thaw cycles as this reduces protein activity .

    • Working aliquots can be stored at 4°C for up to one week .

  • Reconstitution protocol:

    • Briefly centrifuge vials prior to opening to bring contents to the bottom .

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

    • Add 5-50% of glycerol (final concentration) for long-term storage .

  • Construct design for functional studies:

    • Using codon-optimized SLC25A48 cDNA improves expression .

  • Functional assays:

    • Incorporate proper controls (wild-type, rescue, and negative controls) .

    • Use mitochondrial isolation techniques to study transport function .

    • Consider using the MITO-Tag expression system for rapid mitochondrial isolation and metabolite analyses .

How can researchers measure SLC25A48-mediated choline transport activity?

Several methodological approaches can be used to measure SLC25A48-mediated choline transport:

  • Direct mitochondrial choline uptake assays:

    • Isolate mitochondria from wild-type, SLC25A48-KO, or variant-expressing cells.

    • Incubate isolated mitochondria with radiolabeled or fluorescently labeled choline.

    • Measure choline uptake over time using scintillation counting or fluorescence detection.

    • Compare uptake rates between wild-type and SLC25A48-deficient mitochondria .

  • Metabolomic analyses:

    • Use liquid chromatography-mass spectrometry (LC-MS) to measure choline and its metabolites (betaine aldehyde, betaine) in isolated mitochondria.

    • Compare metabolite levels between wild-type, SLC25A48-KO, and rescue cells .

    • The MITO-Tag expression system can be employed for rapid mitochondrial isolation and metabolite analyses .

  • Indirect functional assays:

    • Measure mitochondrial H₂O₂ production as a functional readout of altered choline metabolism .

    • Assess mitochondrial respiration via Complex I and II to evaluate functional consequences of altered choline metabolism .

    • Measure cell proliferation and cell cycle progression as downstream effects of impaired choline metabolism .

  • Rescue experiments:

    • Evaluate whether exogenous betaine supplementation rescues phenotypes associated with SLC25A48 loss.

    • Measure mitochondrial ROS levels before and after betaine treatment in SLC25A48-deficient cells .

  • In vivo validation:

    • Measure plasma and urine choline levels in SLC25A48-deficient or variant-carrying individuals .

    • Correlate SLC25A48 genotypes with plasma choline levels in population studies .

What is the role of SLC25A48 in brown adipose tissue (BAT) thermogenesis?

SLC25A48 plays a critical role in brown adipose tissue thermogenesis through several mechanisms:

  • Expression pattern: SLC25A48 is highly expressed in BAT compared to other tissues, and it is the only SLC25A family protein significantly upregulated in response to high-fat diet (HFD) in BAT .

  • Thermogenic capacity: SLC25A48-KO mice display significantly impaired cold tolerance compared with littermate controls, indicating a defect in BAT thermogenesis .

  • Mitochondrial respiration: Mitochondrial respiration of isolated BAT via complex I and II is significantly attenuated in both male and female SLC25A48-KO mice relative to littermate controls .

  • UCP1-mediated thermogenesis: While UCP1 protein levels remain unchanged in SLC25A48-KO mice, UCP1-mediated thermogenesis is attenuated, as evidenced by no differences in respiration rate in the presence of guanosine diphosphate (GDP) between genotypes .

  • Mitochondrial structure: Electron microscopy analyses reveal that mitochondria in SLC25A48-KO BAT are enlarged and contain less dense cristae than control BAT, suggesting compromised mitochondrial membrane integrity .

  • Complex activity: SLC25A48 loss results in impaired complex I and II activities in BAT mitochondria, potentially due to reduced levels of mitochondrial FAD and other purine nucleotides that are essential for electron transport chain function .

  • ROS production: Mitochondrial H₂O₂ production is significantly elevated in the BAT of SLC25A48-KO mice, indicating increased electron leak and oxidative stress .

These findings highlight the importance of SLC25A48-mediated choline metabolism in maintaining proper mitochondrial function and thermogenic capacity in BAT.

How do genetic variants in SLC25A48 affect its function and human health?

Several genetic variants in SLC25A48 have been identified that affect its function and potentially impact human health:

  • rs200164783 (A>G) SNP:

    • Located at the 3′ end of intron 4 of SLC25A48, this SNP alters a predicted splicing acceptor site .

    • Functional studies show this variant causes exon 5 deletion, which encodes 2 transmembrane domains of the SLC25A48 protein .

    • Cells with this SNP exhibit:

      • Significantly blunted mitochondrial choline uptake

      • Higher mitochondrial H₂O₂ production

      • Altered lipid profiles

      • Reduced cell growth and proliferation

      • Impaired G1-to-S phase transition

  • Loss-of-function mutations:

    • Associated with elevated urine and plasma choline levels .

    • Some mutations (p.R179P and p.R243*) show mis-localization from mitochondria .

    • Other mutations (p.D27G and p.R64L) localize normally but may affect function .

  • Population-level impact:

    • GWAS studies found SLC25A48 variants to be the most significant genetic determinant of plasma choline levels .

    • Integrative rare variant and polygenic score analyses in UK Biobank provide evidence that SLC25A48 causal effects on human disease may be mediated by effects on choline .

    • Eight disease associations were identified in analyses using UK Biobank and BioVU databases .

    • Sex-specific associations have been observed, with some variants influencing choline concentrations in men but not women .

  • Potential clinical implications:

    • Given the role of choline in multiple physiological processes (neurotransmitter synthesis, membrane phospholipid formation, one-carbon metabolism), SLC25A48 variants may affect neurological function, liver metabolism, and cardiovascular health .

    • The association with cell proliferation and cell cycle progression suggests potential involvement in cancer susceptibility or progression .

What is the potential role of SLC25A48 in cancer metabolism and cell proliferation?

SLC25A48 appears to play a significant role in cancer metabolism and cell proliferation:

  • Cell proliferation effects:

    • SLC25A48 deletion significantly attenuates cell proliferation in various cell types .

    • SLC25A48 SNP-KI cells (rs200164783 A>G) show significantly reduced growth compared to wild-type controls .

    • EdU incorporation is significantly lower in SLC25A48-deficient cells, indicating reduced DNA synthesis .

  • Cell cycle regulation:

    • SLC25A48 depletion impairs the G1-to-S phase transition in multiple cancer cell lines .

    • This effect was observed in ovarian cancer cells and U2OS osteosarcoma cells .

  • Cancer cell viability:

    • Genetic loss of SLC25A48 by the CRISPR-Cas9 system results in significant reduction in cell viability across multiple cancer cell lines:

      • Ovarian cancer cells (SKOV3)

      • Pancreas adenocarcinoma (PA-TU-8988T)

      • Non-small-cell lung cancer cell lines (A549 and H1299)

    • Within 24 hours post induction of SLC25A48 depletion, over 50% of ovarian and lung cancer cells died, and 20% of pancreatic cancer cells were dead .

  • Molecular mechanism:

    • SLC25A48's role in choline transport and subsequent betaine synthesis affects purine nucleotide synthesis .

    • Purine nucleotide synthesis is critical for cancer cell proliferation and survival .

    • SLC25A48-KO mitochondria contained significantly lower levels of purine nucleotides (adenine, AMP, dAMP, IMP, and FAD) .

    • Reduced NAD and NADPH levels in SLC25A48-KO cells may also contribute to impaired cancer cell metabolism .

  • Therapeutic implications:

    • SLC25A48 could represent a potential therapeutic target for cancer treatment, particularly in cancers that rely heavily on mitochondrial metabolism .

    • The differential expression of SLC25A48 across tissues suggests targeting might achieve some tissue specificity .

    • Combining SLC25A48 inhibition with other metabolic therapies could enhance anti-cancer effects.

These findings suggest that SLC25A48-mediated choline metabolism is important for cancer cell proliferation and survival, potentially through its effects on purine nucleotide synthesis and mitochondrial function.

What are the most promising approaches for developing SLC25A48 modulators as potential therapeutics?

Based on the current understanding of SLC25A48 function, several approaches show promise for developing modulators:

  • Structure-based drug design:

    • Determination of the 3D structure of SLC25A48 using cryo-EM or X-ray crystallography would facilitate rational design of inhibitors.

    • Focus on the choline-binding pocket and transmembrane domains essential for transport function.

    • In silico screening of chemical libraries against the SLC25A48 structure could identify lead compounds.

  • Peptide-based inhibitors:

    • Development of peptides that mimic critical regions of SLC25A48 involved in choline transport.

    • These peptides could compete with the natural substrate or induce conformational changes that inhibit transport.

  • Small molecule screening:

    • High-throughput screening of compound libraries using assays that measure mitochondrial choline transport.

    • Secondary screens could evaluate effects on downstream metabolites like betaine and purine nucleotides.

  • Antisense oligonucleotides (ASOs) and siRNAs:

    • Development of ASOs or siRNAs targeting SLC25A48 mRNA could achieve tissue-specific knockdown.

    • This approach would be particularly relevant for cancer therapy where systemic delivery to tumor cells is feasible.

  • Allosteric modulators:

    • Identification of allosteric sites that can modulate SLC25A48 transport activity without competing with choline.

    • This approach might offer more specificity compared to active site inhibitors.

  • Targeting cancer-specific vulnerabilities:

    • Developing combination therapies that exploit the dependence of cancer cells on SLC25A48-mediated choline metabolism.

    • For example, combining SLC25A48 inhibitors with drugs that target purine nucleotide synthesis could create synthetic lethality in cancer cells.

Future drug development efforts should consider tissue specificity, potential off-target effects on other choline transporters, and the sex-specific differences observed in SLC25A48 function .

What are the unresolved questions about SLC25A48 function and regulation?

Despite recent advances, several key questions about SLC25A48 remain unanswered:

  • Transport mechanism:

    • What is the exact mechanism of choline transport by SLC25A48?

    • Is the transport active or facilitative?

    • What are the kinetic parameters (Km, Vmax) of choline transport?

    • Does SLC25A48 transport other substrates besides choline?

  • Structural determinants:

    • Which amino acid residues are critical for substrate recognition and transport?

    • How do the six transmembrane domains contribute to the formation of the transport channel?

    • What is the 3D structure of SLC25A48 in different conformational states?

  • Regulatory mechanisms:

    • How is SLC25A48 expression and activity regulated under different physiological conditions?

    • What transcription factors control SLC25A48 gene expression?

    • Are there post-translational modifications that regulate SLC25A48 activity?

    • What explains the sex-specific associations observed in genetic studies?

  • Tissue-specific functions:

    • Why is SLC25A48 highly expressed in BAT, liver, and kidney but not in other mitochondria-rich tissues?

    • Are there tissue-specific binding partners or regulatory factors?

    • Do alternative splice variants exist and contribute to tissue-specific functions?

  • Pathophysiological implications:

    • What is the full spectrum of diseases associated with SLC25A48 dysfunction?

    • How do SLC25A48 variants contribute to metabolic disorders, neurological conditions, or cancer?

    • Could SLC25A48 polymorphisms explain individual variations in response to dietary choline?

  • Evolutionary aspects:

    • Why did SLC25A48 co-evolve with AHCY and SOD2 across species?

    • What selective pressures drove the evolution of mitochondrial choline transport?

    • Are there species-specific differences in SLC25A48 function that might inform human biology?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology .

How might advanced technologies further elucidate SLC25A48 biology and applications?

Several cutting-edge technologies could advance our understanding of SLC25A48:

  • Cryo-electron microscopy (Cryo-EM):

    • Determination of high-resolution structures of SLC25A48 in different conformational states.

    • Visualization of substrate binding and transport mechanisms.

    • Insights into how disease-associated mutations affect protein structure.

  • Single-cell metabolomics:

    • Measurement of choline metabolism at single-cell resolution to understand cellular heterogeneity.

    • Correlation of metabolic profiles with SLC25A48 expression levels in individual cells.

    • Identification of cell populations particularly dependent on SLC25A48 function.

  • CRISPR-based genetic screens:

    • Genome-wide CRISPR screens to identify synthetic lethal interactions with SLC25A48 deficiency.

    • CRISPR activation/inhibition screens to identify regulatory factors controlling SLC25A48 expression.

    • Base editing to systematically assess the functional impact of SLC25A48 variants.

  • Advanced imaging techniques:

    • Live-cell imaging of mitochondrial choline transport using fluorescent choline analogs.

    • Super-resolution microscopy to visualize SLC25A48 distribution within the mitochondrial network.

    • Correlative light and electron microscopy to link structural and functional data.

  • Multi-omics integration:

    • Integration of genomics, transcriptomics, proteomics, and metabolomics data to build comprehensive models of SLC25A48 function.

    • Network analysis to position SLC25A48 within broader metabolic and signaling pathways.

    • Machine learning approaches to predict phenotypic outcomes of SLC25A48 variants.

  • Organoid and tissue-on-chip technologies:

    • Development of organ-specific models to study SLC25A48 function in complex tissue environments.

    • Evaluation of tissue-specific responses to SLC25A48 modulation.

    • Testing potential therapeutic agents in physiologically relevant systems.

  • Metabolic flux analysis:

    • Use of stable isotope-labeled choline to track metabolic fluxes through pathways dependent on SLC25A48.

    • Quantification of how SLC25A48 variants affect metabolic flux distribution.

    • Identification of metabolic bottlenecks in SLC25A48-deficient cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.