Recombinant Bovine Spastin (SPAST)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Spastin (SPAST)

Spastin, encoded by the SPAST gene, is a highly conserved ATPase protein found in organisms ranging from insects to mammals . It belongs to the AAA (ATPases Associated with diverse cellular Activities) protein family and participates in various cellular processes, including membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis . Recombinant Bovine Spastin is produced using genetic engineering techniques to generate the bovine (cow) version of the spastin protein in a laboratory setting, often for research purposes .

Gene and Protein Structure

The SPAST gene codes for spastin, a microtubule-severing protein . Human spastin has two transcript variants encoding distinct isoforms . Alternative splicing can result in multiple transcript variants that encode isoforms that differ in protein regions . Spastin monomers assemble into hexameric, ring-shaped ATPases that sever microtubules along their lengths . Each spastin monomer contains a carboxyl-terminal AAA ATPase catalytic domain and a distinct microtubule-interacting and trafficking (MIT) domain .

Function and Mechanism of Action

Spastin severs microtubules along their lengths, a process distinct from dynamic instability, which occurs spontaneously only at microtubule ends . The AAA domain is critical for its function; most spastin mutations identified in AD-HSP patient cohorts compromise its ATPase activity .

Role in Disease

Mutations in the SPAST gene are the most frequent cause of autosomal dominant hereditary spastic paraplegia (AD-HSP) . In cattle, a mutation in the SPAST gene is associated with congenital bovine spinal dysmyelination (BSD) .

Recombinant Spastin Production and Research Applications

Recombinant spastin proteins are created for in vitro studies to examine the effects of mutations on ATPase activity and microtubule severing . For example, recombinant fusion proteins between spastin and GST (Glutathione S-transferase) have been expressed in E. coli and purified by affinity chromatography to measure ATPase activity . Studies using recombinant spastin have demonstrated that mutations, such as the R560Q substitution found in BSD, can abolish ATPase activity, establishing a causal relationship between loss of catalytic activity and the disease .

Impact of Mutations on Spastin Function

MutationSpeciesEffect on Spastin FunctionDisease AssociationReference
R560QBos taurus (Bovine)Abolishes ATPase activityCongenital Bovine Spinal Dysmyelination (BSD)
I344KHumanLoss of ATPase activity, prolonged half-lifeAutosomal Dominant Spastic Paraplegia
R388 (in Drosophila)Drosophila melanogaster (Fruit Fly)Loss of ATPase and microtubule severing activityFunctional conservation of human Spastin

Spastin Isoforms and Their Functional Differences

Alternative splicing of the SPAST gene results in different isoforms with varying N-terminal lengths, which affects their efficiency in nuclear export . M1 and M87 are two such isoforms; studies have shown that mutant M1 spastin proteins can have toxic effects on axonal transport, independent of microtubule-binding and severing activities .

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill requests to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request, with additional charges applying. Please contact us in advance to arrange this.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference for your experiments.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type will be determined during production. If you have a specific tag requirement, please inform us; we will prioritize fulfilling this request.

Synonyms
SPAST; SPG4; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-614
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
SPAST
Target Protein Sequence
MNSPGGRGKKKGSGGPSSPVPPRPPPPCQARSRPAPKPAPPPQSPHKRNLYYFSYPLFLG FALLRLVAFHLGLLFVWLCQRFSRALMAAKRSSGAAPASASPPAPVPGGEAERVRAFHKQ AFEYISVALRIDEDEKVGQKDQAVEWYKKGIEELEKGIAVVVTGQGEQCERARRLQAKMM TNLVMAKDRLQLLEKLQPSLQFSKSQTDVYNDSTNLTCRNGHLQSESGAVPKRKDPLTHA SNSLPRSKTVMKTGPTGLSGHHRAPSCSGLSMVSGVRQGPGSAAATHKSTPKTNRTNKPS TPTTAARKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQELAKQALQEIVILPS LRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKL VRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLV MGATNRPQELDEAVLRRFTKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTN GYSGSDLTALAKDAALGPIRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLE AYIRWNKDFGDTTV
Uniprot No.

Target Background

Function
Recombinant Bovine Spastin (SPAST) is an ATP-dependent microtubule-severing protein that specifically targets and cleaves polyglutamylated microtubules. It exhibits preferential activity towards microtubules with short polyglutamate tails; severing activity increases with the number of glutamates per tubulin (from one to eight), but decreases beyond this threshold. Activity is independent of tubulin acetylation or detyrosination. Microtubule severing facilitates the reorganization of cellular microtubule arrays and the release of microtubules from the centrosome post-nucleation. SPAST is crucial for the biogenesis and maintenance of complex microtubule networks in axons, spindles, and cilia. It participates in cytokinesis abscission and nuclear envelope reassembly during anaphase, in collaboration with the ESCRT-III complex. Specifically, it is recruited to the midbody (likely via IST1) and contributes to membrane fission during abscission alongside the ESCRT-III complex. Furthermore, IST1 recruits SPAST to the nuclear membrane, mediating microtubule severing, facilitating nuclear envelope sealing, and mitotic spindle disassembly in late anaphase. SPAST is also required for membrane trafficking from the endoplasmic reticulum (ER) to the Golgi apparatus and endosome recycling. IST1 recruits SPAST to endosomes, regulating early endosomal tubulation and recycling through microtubule severing. It likely plays a role in axon growth and the formation of axonal branches.
Gene References Into Functions
  1. Studies have established a direct link between SPAST mutations and bovine spinal dysmyelination. PMID: 19714378
  2. A defective SPAST gene in cattle is associated with a recessive, congenital neurodegenerative disorder characterized by pathological myelin sheath alterations in the spinal cord. PMID: 19714378
Database Links
Involvement In Disease
Defects in SPAST are the cause of bovine spinal dysmyelination (BSD), a neurodegenerative disorder characterized by pathological changes of the myelin sheaths in the spinal cord. Defects appear immediately at birth and include lateral recumbency with slight to moderate opisthotonos, body tremor, and spastic extension of the limbs. General muscle atrophy due to denervation occurs to variable degrees and is most obvious in the hind limbs. BSD is a longstanding problem in the American Brown Swiss (ABS) breed and in several European cattle breeds upgraded with ABS. The morphological cause of the phenotype is bilateral symmetrical hypo- and demyelination of axons in the cervical and thoracic segments of the spinal cord. The disease is caused by mutations affecting the gene represented in this entry.
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Endoplasmic reticulum. Midbody. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Nucleus. Cytoplasm, cytoskeleton, spindle. Cytoplasm.

Q&A

What is bovine SPAST and what is its primary function?

Bovine SPAST encodes a microtubule-severing protein called spastin that plays a critical role in neuronal function. The primary function of spastin is to sever microtubules into smaller segments, which facilitates microtubule reorganization crucial for neurite growth and regeneration . This protein belongs to the AAA (ATPases Associated with diverse cellular Activities) family, which requires ATP hydrolysis to perform its severing function. In cattle, SPAST is particularly important for proper myelination in the spinal cord, and mutations in this gene have been linked to bovine spinal dysmyelination (BSD) .

What are the different isoforms of bovine SPAST?

Similar to human SPAST, bovine SPAST expresses multiple isoforms, with the two main variants being analogous to human M1 (full-length) and M87 (shorter) isoforms. The M1 isoform contains an N-terminal region that is absent in M87. This distinction is functionally significant as:

  • The M1 isoform shows tissue-specific expression predominantly in the adult spinal cord

  • The M87 isoform is ubiquitously expressed across various tissues

  • Only the M1 isoform with mutations has been shown to inhibit fast axonal transport (FAT) in experimental models

Understanding these isoform differences is crucial when designing experiments with recombinant bovine SPAST, as the isoform selection can significantly impact observed biological effects.

How does the ATPase domain function in bovine SPAST?

The ATPase domain in bovine SPAST is highly conserved and critical for its microtubule-severing activity. This domain:

  • Binds and hydrolyzes ATP to generate energy for microtubule severing

  • Contains sites where disease-causing mutations frequently occur

  • Includes the R560 residue, which when mutated to glutamine (R560Q) in cattle, severely impairs ATPase activity and causes BSD

Experimental approaches to study this domain typically involve site-directed mutagenesis to create recombinant proteins with specific amino acid substitutions, followed by in vitro ATPase activity assays to measure functional consequences.

What expression systems yield functional recombinant bovine SPAST?

When expressing recombinant bovine SPAST, the choice of expression system is critical for obtaining properly folded, active protein. Based on published methodologies:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications, inclusion body formation commonStructure studies, antibody production
Insect cellsBetter folding, some post-translational modificationsMore complex, moderate yieldFunctional assays, protein-protein interaction studies
Mammalian cellsNative-like folding and modificationsLower yield, higher cost, time-consumingCellular localization studies, in vivo activity assays

For functional studies of bovine SPAST's microtubule-severing activity, insect or mammalian cell expression systems are generally preferred to ensure proper protein folding and post-translational modifications that may be crucial for enzyme activity.

What purification methods yield the highest activity of recombinant bovine SPAST?

A methodological approach for high-yield purification of active recombinant bovine SPAST typically follows these steps:

  • Generate expression constructs with appropriate tags (His, GST, or FLAG) for the selected isoform (M1 or M87)

  • Express protein under optimized conditions (temperature, induction time, media composition)

  • Lyse cells using mild detergents to preserve protein structure

  • Implement a two-step purification process:

    • Initial affinity chromatography based on the fusion tag

    • Secondary size-exclusion or ion-exchange chromatography for higher purity

  • Verify purification by SDS-PAGE and Western blotting with anti-SPAST antibodies

  • Perform activity assays to confirm functional integrity

For bovine SPAST specifically, maintaining the protein in buffers containing ATP or non-hydrolyzable ATP analogs during purification can help stabilize the protein structure and preserve its activity.

How can I measure the microtubule-severing activity of recombinant bovine SPAST?

To quantitatively assess microtubule-severing activity of recombinant bovine SPAST, researchers can employ several complementary methodologies:

  • In vitro microtubule severing assay:

    • Polymerize fluorescently labeled tubulin into microtubules

    • Immobilize microtubules on glass coverslips

    • Add purified recombinant SPAST at defined concentrations

    • Use time-lapse microscopy to visualize and quantify severing events

    • Calculate severing rate as the number of breaks per microtubule length per time

  • ATPase activity coupling:

    • Measure ATP hydrolysis rate using a coupled enzymatic assay

    • Compare ATPase activity in the presence and absence of microtubules

    • Calculate the stimulation of ATPase activity by microtubules as an indirect measure of binding and function

  • Cellular microtubule network analysis:

    • Express recombinant bovine SPAST in cultured cells

    • Visualize microtubule network by immunofluorescence

    • Quantify microtubule density and organization

    • Compare wild-type SPAST with ATPase-deficient mutants like R560Q

These approaches should be used in combination to comprehensively characterize SPAST activity.

How does ATP concentration affect the activity of recombinant bovine SPAST?

The ATPase activity of bovine SPAST follows Michaelis-Menten kinetics, with important experimental considerations:

  • At low ATP concentrations (<100 μM), activity increases linearly with ATP concentration

  • The Km for ATP typically falls in the range of 200-400 μM for wild-type SPAST

  • Disease-causing mutations like R560Q show significantly impaired ATPase activity with much higher Km values

  • ATP concentrations ≥2 mM are typically used for in vitro severing assays to ensure maximum activity

When conducting kinetic experiments, researchers should:

  • Use a range of ATP concentrations (50 μM to 2 mM)

  • Include appropriate controls (no ATP, non-hydrolyzable ATP analogs)

  • Compare wild-type and mutant proteins under identical conditions

  • Account for the effects of divalent cations (Mg2+) which are required cofactors

How does the R560Q mutation affect bovine SPAST function?

The R560Q mutation in bovine SPAST represents a critical model for understanding structure-function relationships. Experimental evidence demonstrates that:

  • The R560 residue is located in the highly conserved ATPase domain

  • This position is invariant from insects to mammals, indicating its evolutionary importance

  • The R560Q substitution severely impairs ATPase activity in biochemical assays

  • Homozygous R560Q mutations cause bovine spinal dysmyelination (BSD), a recessive congenital neurodegenerative disease

  • Equivalent mutations in human SPAST cause hereditary spastic paraplegia (HSP)

Research methods to analyze this mutation include:

  • Recombinant protein expression of wild-type and R560Q mutant versions

  • Comparative ATPase activity assays

  • Microtubule binding and severing assays

  • Structural studies to understand the molecular basis for dysfunction

These approaches have demonstrated that the R560Q mutation significantly reduces the ATPase activity of bovine SPAST, providing a direct causal link between this molecular defect and the observed disease phenotype .

How can cellular models be used to study bovine SPAST mutations?

Cellular models provide valuable systems for investigating the pathophysiological mechanisms of bovine SPAST mutations. Effective methodological approaches include:

  • Primary neuronal cultures:

    • Isolate neurons from bovine embryos with different SPAST genotypes

    • Analyze neurite outgrowth, branching, and regeneration after injury

    • Evaluate microtubule dynamics and organization in real-time

  • Transfected cell lines:

    • Express wild-type or mutant bovine SPAST in neuronal or non-neuronal cell lines

    • Assess effects on microtubule network, organelle distribution, and cellular morphology

    • Perform live-cell imaging to track cellular dynamics

  • CRISPR/Cas9 gene editing:

    • Generate isogenic cellular models with specific SPAST mutations

    • Study mutation-specific effects in a controlled genetic background

    • Compare different mutations to establish genotype-phenotype correlations

These cellular models can reveal functional consequences of SPAST mutations, particularly how they affect axonal transport, a process critical for neuronal health and implicated in neurodegenerative diseases associated with SPAST mutations .

How does the 14-3-3/spastin pathway regulate neuronal regeneration?

The interaction between 14-3-3 proteins and spastin represents an important regulatory mechanism with implications for neuronal regeneration. Research methodologies to study this pathway include:

  • Co-immunoprecipitation assays:

    • These have demonstrated that all 14-3-3 isoforms (β, γ, ε, ζ, η, θ) can interact with spastin

    • GST pull-down assays further confirm these interactions

    • These techniques can be applied to bovine SPAST to investigate species-specific interactions

  • Phosphorylation site analysis:

    • 14-3-3 binding to spastin is regulated by phosphorylation, particularly at residue S233

    • Phosphorylation-mimicking mutations (S233D) protect spastin from degradation

    • Similar phosphorylation sites likely exist in bovine SPAST

  • Protein stability assays:

    • 14-3-3 proteins protect spastin from degradation through the ubiquitin-proteasome pathway

    • Cycloheximide chase assays demonstrate increased stability of spastin when bound to 14-3-3

    • MG132 (proteasome inhibitor) experiments reveal the involvement of proteasomal degradation

After spinal cord injury, spastin levels initially decrease but gradually recover over a 30-day period. Experimental enhancement of the 14-3-3/spastin interaction using compounds like FC-A can increase spastin levels and potentially promote neuronal regeneration following injury .

What role does bovine SPAST play in axonal transport?

Research on spastin's impact on fast axonal transport (FAT) has revealed isoform-specific effects relevant to disease pathology. Key findings and methodologies include:

  • Isolated axoplasm studies:

    • Squid giant axon preparations allow direct measurement of FAT rates

    • Mutant M1 spastin, but not M87 spastin, inhibits both anterograde and retrograde FAT

    • This approach can be applied to study bovine SPAST isoforms and mutations

  • Live-cell transport assays:

    • Tracking labeled vesicles, mitochondria, or other organelles in cultured neurons

    • Measuring transport velocities, run lengths, and pause frequencies

    • Comparing effects of wild-type versus mutant bovine SPAST expression

  • Mechanistic investigations:

    • Casein kinase 2 (CK2) has been identified as a critical mediator of mutant spastin-induced FAT deficits

    • Pharmacological CK2 inhibitors can correct organelle distribution abnormalities caused by mutant M1 spastin

    • Similar approaches can determine if bovine SPAST mutations operate through the same mechanisms

These methodologies have established that pathogenic effects of mutant spastin on axonal transport are specific to the M1 isoform and independent of microtubule-binding or severing activity, highlighting the importance of studying both major isoforms in bovine models .

How should controls be designed for bovine SPAST functional studies?

Proper experimental controls are essential for reliable interpretation of bovine SPAST functional studies. A comprehensive control strategy should include:

Control TypePurposeImplementation
Negative ControlsDetect background activity or false positivesBuffer-only, heat-inactivated SPAST, ATPase-dead mutants (E442Q)
Positive ControlsValidate assay functionalityRecombinant human SPAST with known activity, other microtubule-severing proteins
Isoform ControlsAccount for isoform-specific effectsInclude both M1 and M87 isoforms in parallel experiments
Mutation ControlsDistinguish mutation-specific effectsCompare multiple mutations (R560Q, C448Y, L195V, E112K)
Species ControlsIdentify species-specific variationsCompare bovine SPAST with human or mouse orthologs

Adhering to these control strategies ensures experimental rigor and facilitates cross-study comparisons in the scientific literature.

How can I resolve contradictory data when studying bovine SPAST?

When faced with contradictory results in bovine SPAST research, consider the following methodological approaches:

  • Isoform verification:

    • Confirm which spastin isoform (M1 vs. M87) was used in each study

    • Different isoforms can exhibit dramatically different effects, particularly in transport studies

  • Expression level considerations:

    • Dose-dependent effects are common with SPAST

    • Excess spastin can be toxic by destroying the microtubule network

    • Insufficient spastin limits microtubule remodeling needed for regeneration

  • Post-translational modification status:

    • Phosphorylation state affects SPAST stability and function

    • 14-3-3 protein interactions vary with phosphorylation state

    • Interaction with ubiquitination machinery affects protein levels

  • Experimental system differences:

    • In vitro vs. cellular vs. in vivo systems can yield different results

    • Species-specific differences in SPAST regulation may exist

    • Cell-type specific effects need to be considered (neuronal vs. non-neuronal cells)

By systematically addressing these variables, researchers can often reconcile seemingly contradictory findings and develop a more comprehensive understanding of bovine SPAST biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.