Recombinant Bovine Spermatid maturation protein 1 (SPEM1)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

SPEM1, or Spermatid Maturation 1, is a gene that encodes for the SPEM1 protein . The SPEM1 protein is found exclusively in the testis . Alignment analyses of SPEM1 orthologs have revealed that they are highly conserved during evolution . Human SPEM1 is located on chromosome 11 .

Expression and Function

SPEM1 is a testis-specific gene expressed in a stage-specific manner in developing spermatids, specifically steps 6-15 . SPEM1 protein is exclusively detected in the testis . Male mice deficient in Spem1 were completely infertile because of deformed sperm characterized by a bent head wrapped around by the neck and the middle piece of the tail . The absence of Spem1 causes the cytoplasm to not detach from the head and neck region of developing spermatozoa, leading to sperm deformation and male infertility . SPEM1 may be considered the best post-meiotic marker, which can predict the availability of spermatozoa .

Structure and Characteristics

The SPEM1 protein contains no known functional domains . The Spem1 transcript is approximately 1.2 kb in size . One study obtained sequences of the full-length cDNA for this gene, which was then deposited to GenBank (accession number EF120626) . The protein sequence consists of 310 amino acids .

Clinical Significance

Among seven testis-specific molecular markers, SPEM1 appears to have significant clinical value for predicting sperm retrieval in azoospermic men .

Research Findings

  • Aberrant Cytoplasm Removal: Research indicates that a lack of Spem1 leads to the failure of cytoplasm detachment from the head and neck of developing spermatozoa. This retention of cytoplasmic components obstructs the straightening of the sperm head and the stretching of the tail, resulting in the head bending at the neck and being wrapped by the neck or middle piece of the tail .

  • Sperm Deformation: Studies on Spem1-null sperm using scanning electron microscopy (SEM) have revealed three main types of deformation in the head/neck region: the sperm head bending at the neck region towards the tail at 180 degrees, the head bending gradually with the neck appearing divided with a groove, and the neck/middle piece wrapping around the head .

  • Infertility: Male mice lacking Spem1 are infertile due to sperm deformation. Approximately 85% of Spem1-null sperm display a bent head .

  • Testis-Specific Expression: Multitissue Northern blot analyses and RT-PCR amplification confirm that Spem1 mRNA is exclusively detected in the testis .

  • Ultrastructural Defects: Transmission electron microscopy (TEM) shows that the head bends at the neck/middle piece, held together by membranous tissues resembling shed cytoplasm. These tissues contain interconnected membranous vacuoles, myelin-like discs, and large vacuoles .

  • Cytoplasmic Droplets: Spem1-null sperm lack cytoplasmic droplets, which are normally located between the neck and middle piece of the sperm tail in wild-type mice .

  • Genetic Regulation: Proper cytoplasm removal is a genetically regulated process that requires Spem1 .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPEM1; Spermatid maturation protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SPEM1
Target Protein Sequence
MAMAERPRPGWASYHNPNTNSCQDLGNSILLLLGLIICINIGINMVTLLWRRLRGFLHQV FRVICEKEASKLRSPGKQTQPSKHSSPAVHLRCTMDAVKMTVTPPPTRRRHRRGSSSRRA RRPVAWAPDTDDDDDEKPPHQHTAACSHNWDYPEDWEGLQTAQRFWTPWAQDTLEPPTQT IRFQQTIEGRPLKREMQSDLGLEAYVYPVNPPLPSPQILSHKNSGGGAGAGAQAEQEQCA PAEPPILGPANVPDIPRRRSSGRVTYDARDVRRRLRELTREVEALSHCYPLASGSSTAEG TRKDWVYRSMTER
Uniprot No.

Target Background

Function
Essential for efficient cytoplasm removal during spermatogenesis.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm.

Q&A

What is Spermatid maturation protein 1 (SPEM1) and what is its cellular expression pattern?

SPEM1 is a protein encoded by the spermatid maturation 1 gene that is exclusively expressed in the cytoplasm of steps 14-16 elongated spermatids in the testis. This protein contains no known functional domains but demonstrates high conservation across mammalian species. SPEM1 expression shows a stage-specific pattern during spermatogenesis, with stronger immunoreactivity detected at stages III–VII and weaker signals at stages I, II, and VIII of the seminiferous epithelium cycle .

The expression of SPEM1 is strictly confined to elongated spermatids that are about to be released from the seminiferous epithelium, suggesting its critical role in late spermiogenesis. Interestingly, the onset of SPEM1 protein expression occurs later than that of its mRNA, reflecting a common phenomenon in genes functioning during late spermiogenesis where transcription ceases during chromatin condensation around step 9 .

What is the physiological function of SPEM1 during spermatogenesis?

SPEM1 plays an essential role in proper cytoplasm removal during spermiogenesis. In its absence, cytoplasmic components fail to detach from the head and neck region of developing spermatozoa. This retention mechanically obstructs normal sperm morphogenesis, specifically:

  • Prevents straightening of the sperm head

  • Impedes proper stretching of the growing tail

  • Results in bending of the head in the neck region

  • Leads to the characteristic wrapping of the head by the neck or middle piece of the sperm tail

The majority of SPEM1 protein is removed into residual bodies after spermiation (stages IX–X), confirming its function is primarily during late spermiogenesis rather than during posttesticular maturation of spermatozoa .

What phenotypes are observed in SPEM1-deficient animal models?

Male mice deficient in SPEM1 display complete infertility. The hallmark phenotype is severely deformed spermatozoa characterized by a "head-bent-back" abnormality with 100% penetrance . The deformed morphology includes:

  • Bent sperm heads wrapped around by the neck

  • Middle piece of the tail folding back on the head

  • Failure of cytoplasm to become loose and detach from the head and neck regions

  • Retained cytoplasmic components that mechanically obstruct normal sperm development

This phenotype demonstrates that proper cytoplasm removal is not a passive process but rather a genetically regulated mechanism requiring specific proteins like SPEM1 .

What are the known protein-protein interactions of SPEM1?

SPEM1 has been identified to interact with several proteins, most notably UBQLN1 (Ubiquilin-1). This interaction was discovered through yeast two-hybrid screening assays where SPEM1 was used as bait to identify binding partners from an adult mouse testis cDNA library .

The verification of this interaction included:

  • Co-transformation assays on selective media

  • Confirmation of interaction using both vectors: pGDT7/Ubiquilin1 with pGBKT7/SPEM1

  • Co-localization studies in elongating spermatids

The interaction between SPEM1 and UBQLN1 is particularly significant because UBQLN1 functions by binding and directing poly-ubiquitinated proteins to the proteasome for degradation, suggesting a role for SPEM1 in the regulation of protein ubiquitination during spermiogenesis .

How does the SPEM1-UBQLN1 interaction regulate protein ubiquitination during spermiogenesis?

The SPEM1-UBQLN1 interaction provides important insights into the molecular mechanisms of cytoplasm removal during spermiogenesis. UBQLN1 and SPEM1 were found to be colocalized to the manchette of elongating spermatids, a transient microtubular structure involved in nuclear shaping and protein transport .

The functional significance of this interaction likely relates to the ubiquitin-proteasome system's role during spermiogenesis:

  • UBQLN1 contains a ubiquitin-like domain and a ubiquitin-associated domain

  • It serves as a shuttle factor that delivers ubiquitinated proteins to the proteasome

  • The interaction with SPEM1 suggests that SPEM1 may regulate which proteins are targeted for degradation

  • This protein turnover appears critical for the cytoplasmic remodeling that occurs during late spermiogenesis

This interaction provides a molecular framework for understanding how cytoplasmic components are selectively removed during sperm maturation, a process that when disrupted leads to male infertility .

What techniques are optimal for producing recombinant SPEM1?

While the provided search results don't specifically describe recombinant SPEM1 production methods, insights can be drawn from related recombinant protein production strategies as demonstrated with recombinant BSP1:

For optimal expression of recombinant proteins in soluble form:

  • Clone the full-length SPEM1 ORF into an appropriate expression vector (such as p3XFLAG-myc-CMVTM-26)

  • Confirm in-frame insertion through sequencing analysis to ensure mutation-free expression

  • For prokaryotic expression systems, optimize conditions:

    • IPTG concentration (e.g., 1 mM)

    • Lower incubation temperature (e.g., 16°C)

    • Extended expression time (e.g., 22 hours)

  • For purification, incorporate affinity tags (like 6-His) for purification using affinity chromatography (e.g., Ni-NTA)

The challenging aspect of recombinant sperm protein production is achieving proper protein folding, which is essential for maintaining functional activity. Expression at lower temperatures often helps promote correct folding and solubility .

How can the functional activity of recombinant SPEM1 be verified?

Verification of recombinant SPEM1 function should include:

  • Structural integrity assessment:

    • Molecular modeling and 3D structure prediction

    • Circular dichroism to assess secondary structure elements

    • Thermal stability studies

  • Interaction studies:

    • Co-immunoprecipitation with known binding partners (e.g., UBQLN1)

    • Western blot analysis to confirm protein size and immunoreactivity

    • Binding assays with potential ligands

  • Functional assays:

    • Effects on sperm parameters when added to sperm preparations

    • Localization studies using tagged recombinant protein

    • In vitro assessment of cytoplasm removal processes

Based on related recombinant protein studies, proper folding and activity can be confirmed through both in silico methods (molecular dynamics simulations) and in vitro functional assays .

What experimental designs are effective for studying SPEM1 interactions with other proteins?

Several methodological approaches can be employed to study SPEM1 interactions:

Yeast Two-Hybrid System:

  • Construct bait vector with SPEM1 cDNA (e.g., subcloning into pGBKT7 vector)

  • Transform into yeast competent cells (e.g., Y187)

  • Mate with cells containing prey constructs (adult mouse testis cDNA library)

  • Select positive interactions on selective medium (SD/-Leu/-Trp/-Ade/-His)

  • Verify through co-transformation assays and sequencing analysis

Co-Immunoprecipitation in Mammalian Cells:

  • Co-transfect expression vectors (e.g., p3XFLAG-Spem1 and pcDNA3.1/V5-Ubqln1)

  • Culture cells at 37°C with 5% CO2 for 48h

  • Harvest cells and perform protein extraction

  • Immunoprecipitate with anti-FLAG antibodies

  • Detect interacting proteins by Western blot

Bimolecular Fluorescence Complementation:

  • Fuse SPEM1 to N-terminal fragment of fluorescent protein

  • Fuse potential interacting protein to C-terminal fragment

  • Co-transfect into mammalian cells

  • Examine for reconstituted fluorescence indicating protein-protein interaction

These approaches provide complementary data on protein interactions both in vitro and in cellular contexts .

How does SPEM1 expression and function compare across mammalian species?

SPEM1 shows high conservation across mammalian species, suggesting evolutionary pressure to maintain its function in spermatogenesis. Comparative analysis reveals:

  • The protein contains no known functional domains but maintains structural conservation

  • Expression pattern is consistently confined to late-stage elongating spermatids

  • Function in cytoplasm removal appears to be conserved

  • Species-specific variations may exist in timing and regulation of expression

This conservation underscores the fundamental importance of SPEM1 in mammalian spermatogenesis and male fertility .

What methodologies are most effective for detecting endogenous SPEM1 expression?

For accurate detection of endogenous SPEM1, several complementary approaches should be employed:

In Situ Hybridization:

  • Generate SPEM1-specific antisense riboprobes

  • Perform hybridization on testicular sections

  • Examine stage-specific expression patterns (signals typically confined to luminal compartment)

  • Include sense probe controls to assess background levels

Immunohistochemistry:

  • Use polyclonal antibodies raised against full-length SPEM1

  • Apply to testicular sections with appropriate controls

  • Analyze stage-specific localization patterns

  • Document expression confined to steps 14-16 spermatids

Western Blot Analysis:

  • Extract proteins from stage-specific seminiferous tubule segments

  • Separate by SDS-PAGE and transfer to membrane

  • Probe with anti-SPEM1 antibodies

  • Confirm specificity through knockout controls

The combination of mRNA and protein detection methods provides comprehensive insight into expression patterns, with the notable finding that protein expression onset is delayed compared to mRNA expression, a common phenomenon for proteins functioning in late spermiogenesis .

What are potential applications of recombinant SPEM1 in fertility research?

Recombinant SPEM1 has several potential applications in fertility research:

  • Diagnostic tool:

    • Development of assays to assess cytoplasm removal efficiency in sperm

    • Potential biomarker for certain forms of male infertility

  • Therapeutic applications:

    • Supplementation in assisted reproductive technologies

    • Correction of cytoplasmic retention abnormalities

  • Research applications:

    • Study of molecular mechanisms of spermiogenesis

    • Investigation of protein-protein interactions during sperm development

    • Development of targeted interventions for male fertility issues

  • Cryopreservation enhancement:

    • Potential additive to improve sperm quality during freezing/thawing

    • Protection against damage during preservation processes

These applications could advance both basic understanding of sperm development and applied technologies in reproductive medicine .

What are the main technical challenges in working with recombinant SPEM1?

Several technical challenges exist when working with recombinant SPEM1:

  • Protein solubility and folding:

    • Maintaining proper folding during recombinant expression

    • Preventing aggregation and inclusion body formation

    • Optimizing expression conditions (temperature, induction time, media composition)

  • Functional activity preservation:

    • Ensuring recombinant protein retains native activity

    • Developing appropriate functional assays to verify activity

    • Understanding post-translational modifications that may be required

  • Species-specific considerations:

    • Accounting for differences between bovine and other mammalian SPEM1

    • Ensuring cross-species applicability in functional studies

    • Validating antibodies and detection methods across species

  • In vitro to in vivo translation:

    • Correlating in vitro findings with in vivo physiological relevance

    • Developing appropriate animal models for testing

    • Accounting for the complex environment of the testis/epididymis

Addressing these challenges requires multidisciplinary approaches combining molecular biology, structural biology, and reproductive physiology techniques .

What future research directions could advance understanding of SPEM1 function?

Several promising research directions could enhance our understanding of SPEM1:

  • Molecular mechanism elucidation:

    • Detailed characterization of SPEM1-UBQLN1 interaction and its role in protein degradation

    • Identification of additional SPEM1 binding partners

    • Determination of exact mechanism by which SPEM1 facilitates cytoplasm removal

  • Structural biology approaches:

    • Crystal structure determination of SPEM1

    • Molecular dynamics simulations to understand functional domains

    • Structure-function relationship studies using directed mutagenesis

  • Translational applications:

    • Development of SPEM1-based diagnostic tools for male infertility

    • Exploration of SPEM1 as a target for male contraception

    • Application in assisted reproductive technologies

  • Evolutionary studies:

    • Comparative analysis of SPEM1 across species with different reproductive strategies

    • Investigation of how SPEM1 function has evolved alongside sperm morphological diversity

These research directions would contribute significantly to both basic reproductive biology and applied clinical andrology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.