Recombinant Bovine Spermatogenesis-associated protein 9 (SPATA9)

Shipped with Ice Packs
In Stock

Description

Introduction

Spermatogenesis-associated protein 9 (SPATA9) is a protein that is associated with spermatogenesis. SPATA9 is expressed exclusively in the testis and localized specifically on the acrosomal compartment of intact human spermatozoa . It may play a role in spermatozoa–egg interaction . SPATA9 was earlier defined as JIP3γ scaffolding protein and has been recently classified as JIP4 protein .

Gene Information

The human SPATA9 gene is located on chromosome 17q21.33 . The mouse SPATA9 gene is located on chromosome 11 and is syntenic with the human SPATA9 gene . The Gene ID for SPATA9 (Homo sapiens) is 83890, updated on 4-Jan-2025 .

Protein Structure and Function

SPATA9 protein has structural homology with JNK (c-Jun N-terminal kinase)-interacting protein 3 . SPATA9 is structurally distinct from the previously described JIP1 and JIP2 proteins . SPATA9 contains a JBD (JNK-binding domain), leucine zipper, and transmembrane domains .

Expression

SPATA9 is expressed exclusively in testis . SPATA9 is expressed in haploid round spermatid cells during spermatogenesis in the macaque, baboon, and human .

Role in Sperm-Egg Interaction

Anti-SPATA9 antibodies inhibit the binding of human spermatozoa to intact human oocytes as well as to matched hemizona . SPATA9 may have a role in spermatozoa-egg interaction .

Association with Male Infertility

1700029I15Rik stabilizes OST subunits and specifically mediates the processing of acrosomal membrane proteins in the ER of early round spermatids . Discoveries in mice may provide insights into the etiology of idiopathic male infertility and the development of a nonhormonal contraceptive approach involving molecular interventions in the biosynthesis of acrosomal membrane proteins, given that 1700029I15Rik is highly conserved in humans .

Genome-Wide Association Studies (GWAS)

SPATA9 has been identified as a potential gene of interest via gene function annotations and location .

SPATA9 mutations

Mutant SPATA9ΔT (SPATA9 without transmembrane domain; comparable with 111–2080 bp of the published human SPATA9, amino acid residues from 1 to 658; 108 amino acids deleted at the C-terminus, which has a predicted transmembrane domain, Figure 1A) and a mutant SPATA9ΔLZΔT (SPATA9 without JBD, leucine zipper and transmembrane domains; comparable with 934–2080 bp of the published human SPATA9, amino acid residues from 276 to 658; 275 amino acid residues deleted at the N-terminus, which has JBD, leucine zipper, a portion of the coiled-coil and also the 108 amino acid residues deleted at the C-terminus having its predicted transmembrane domain, Figure 1A) were amplified by PCR with the following primers: forward 5′-ATGTCCATAATTATATGGAACATTTA-3′ and reverse 5′ .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SPATA9; Spermatogenesis-associated protein 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SPATA9
Target Protein Sequence
MPIKPVGWICGQVLKNFSGRIEGIQKVIMDLIDEFKDEFPTILRLSQSNQKREPMQKPSK IRMAIALAKINRGTLIQGLNSISRSSKSVAKLLQPQLACRLLELRAISHRLLKEVNAPRQ PLYNIQVRKGSLFEIISFPAKTALTSIMCASYAALIYLTVCVNAVLEKIMKIFQEEESIR QNREESENFRNAFSEPVLSEPLFPEGEIKAKPYRSLPEKPDSISDRPKLPANKLSNKIQV LHSVFDQSAEMNE
Uniprot No.

Target Background

Function
Plays a potential role in testicular development and spermatogenesis, and may be a significant factor in male infertility.
Database Links

KEGG: bta:613406

UniGene: Bt.50388

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the function of SPATA9 in bovine spermatogenesis?

SPATA9 is a spermatogenesis-associated protein that likely plays a critical role in male germ cell development in cattle. While specific functions of SPATA9 are still being elucidated, it can be compared to other spermatogenesis-associated proteins such as PRAMEY, which has been characterized as a male germ cell-specific protein involved in acrosome biogenesis and spermatogenesis in cattle . Based on structural homology with other spermatogenesis proteins, SPATA9 may be involved in cellular processes critical for proper spermatid development, potentially including acrosomal formation, chromatin remodeling, or flagellar development.

For researchers investigating SPATA9 function, immunolocalization studies combined with co-immunoprecipitation experiments would provide valuable insights into its cellular distribution and potential interaction partners, similar to methodologies used for other spermatogenesis-associated proteins .

What expression pattern does SPATA9 exhibit during bovine spermatogenesis?

The expression pattern of SPATA9 likely varies across different stages of spermatogenesis. Drawing parallels with other spermatogenesis-associated proteins like PRAMEY, SPATA9 may show stage-specific expression patterns in bovine testes. PRAMEY, for instance, exists in multiple isoforms, with the intact protein (58 kDa) detected in testes of different ages but not in epididymal spermatozoa, while a 30 kDa isoform is highly expressed only in post-pubertal testes and epididymal spermatozoa .

To characterize SPATA9 expression patterns, researchers should employ:

  • Western blot analysis of testicular tissue from bulls of different ages

  • RT-qPCR to quantify temporal expression during development

  • Immunohistochemistry on testicular sections to identify cell-type specific expression

  • Proteomic analysis to identify potential isoforms or post-translational modifications

What methods are recommended for producing recombinant Bovine SPATA9?

Production of recombinant Bovine SPATA9 typically follows established protocols for mammalian protein expression, with several methodological considerations:

  • Expression System Selection:

    • Prokaryotic (E. coli): Suitable for structural studies but may lack post-translational modifications

    • Mammalian (HEK293, CHO): Preserves native folding and modifications but with lower yield

    • Insect cells (Sf9, Hi5): Balance between yield and post-translational modifications

  • Construct Design:

    • Include appropriate tags (His, GST, etc.) for purification

    • Consider codon optimization for the chosen expression system

    • Include TEV or PreScission protease sites for tag removal

  • Purification Strategy:

    • Initial capture via affinity chromatography

    • Further purification using ion exchange and size exclusion chromatography

    • Quality assessment via SDS-PAGE and Western blotting

When working with recombinant SPATA9, researchers must adhere to the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, which specify biosafety practices and containment principles for handling recombinant nucleic acids and cells containing such molecules .

How can researchers validate the specificity of anti-SPATA9 antibodies?

Antibody validation is critical for reliable SPATA9 research. A systematic approach includes:

  • Western Blot Analysis:

    • Test against recombinant SPATA9 protein

    • Analyze testicular lysates from different developmental stages

    • Include appropriate negative controls (e.g., non-reproductive tissues)

    • Perform peptide competition assays to confirm specificity

  • Immunohistochemistry Validation:

    • Compare staining patterns with known expression profiles

    • Conduct parallel experiments with different antibodies targeting different epitopes

    • Include knockout or knockdown samples as negative controls when available

  • Cross-reactivity Assessment:

    • Test against closely related proteins

    • Evaluate species cross-reactivity if conducting comparative studies

A properly validated antibody should show consistent localization patterns across different experimental approaches and align with mRNA expression data.

What experimental approaches are optimal for studying SPATA9 protein interactions during spermatogenesis?

To investigate SPATA9 protein interactions, researchers should employ complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-SPATA9 antibodies to pull down protein complexes from testicular lysates

    • Identify interaction partners through mass spectrometry

    • Validate key interactions with reverse Co-IP experiments

  • Proximity Labeling Techniques:

    • BioID or APEX2 fusion proteins to identify proteins in close proximity to SPATA9

    • TurboID for rapid labeling of neighboring proteins in living cells

  • Yeast Two-Hybrid Screening:

    • Library screening to identify potential interactors

    • Validation of positive hits through directed Y2H assays

  • Fluorescence Microscopy:

    • Co-localization studies with potential interactors

    • FRET or FLIM-FRET for direct interaction evidence

    • Super-resolution microscopy to precisely map spatial relationships

Drawing from studies of similar proteins, SPATA9 might interact with phosphatases like PP1γ2, which is testis/spermatozoa-specific and regulates spermatozoal motility and male fertility . The interaction network could provide insights into SPATA9's functional role in spermatogenesis.

How can researchers predict and validate the impact of SPATA9 missense variants on protein function?

Analysis of SPATA9 missense variants requires a structured approach combining computational prediction and experimental validation:

Computational Prediction Methods:

  • Deep Learning Models:

    • AlphaMissense provides state-of-the-art performance for predicting variant pathogenicity, achieving higher accuracy than previous methods on clinical benchmarks

    • The model considers both sequence and predicted structural context, which contributes to its performance

  • Integration with Structural Information:

    • Map variants onto predicted protein structures

    • Evaluate potential disruption of functional domains

    • Assess conservation across species

Experimental Validation Approaches:

  • Multiplexed Assays of Variant Effects (MAVEs):

    • Deep mutational scanning to assess functional impact of many variants simultaneously

    • Cell-based assays measuring protein activity or stability

  • Functional Assays:

    • Expression of variant proteins in heterologous systems

    • Assessment of subcellular localization, stability, and interaction capacity

    • CRISPR-mediated introduction of variants into cell lines or animal models

Prediction ToolKey FeaturesApplicability to SPATA9
AlphaMissenseCombines sequence and structural context; 90% precision on clinical variants Suitable for all proteins with available sequence data
EVESpecialized for clinical variant interpretationUseful for clinical correlation studies
GEMMEBased on evolutionary informationGood for evolutionarily conserved domains

When interpreting variant predictions, consider that reduced performance may occur for residues predicted to be disordered , which may be relevant for intrinsically disordered regions in SPATA9.

What are the biosafety considerations and regulatory requirements for research with recombinant SPATA9?

Research with recombinant SPATA9 must comply with institutional and national guidelines for biosafety:

  • NIH Guidelines Compliance:

    • Research involving recombinant or synthetic nucleic acids falls under NIH Guidelines, which specify biosafety practices and containment principles

    • Experiments must receive appropriate approvals before initiation

  • Institutional Biosafety Committee (IBC) Review:

    • All recombinant DNA research requires IBC approval

    • Risk assessment should consider the nature of the protein and expression systems used

  • Containment Levels:

    • Most SPATA9 work likely falls under Biosafety Level 1 or 2, depending on expression system

    • Higher containment may be necessary if combining with viral vectors or pathogenic organisms

  • Documentation Requirements:

    • Maintain detailed records of experimental protocols

    • Document risk assessments and mitigation strategies

    • Keep training records for all personnel

Researchers should note that according to Section I-C-1-a-(1) of the NIH Guidelines, institutions receiving any support for recombinant or synthetic nucleic acid research from NIH must comply with these guidelines .

How can researchers study the relationship between SPATA9 expression/mutations and male fertility parameters in cattle?

Investigating connections between SPATA9 and fertility requires integrative approaches:

  • Genotype-Phenotype Association Studies:

    • Screen bull populations for SPATA9 variants

    • Correlate variants with fertility metrics (conception rates, semen parameters)

    • Consider Copy Number Variation (CNV) analysis, as CNVs in other spermatogenesis genes like PRAMEY have been associated with testis size and male fertility in cattle

  • Expression Analysis in Fertility-Stratified Samples:

    • Compare SPATA9 expression levels between bulls with varying fertility

    • Analyze both mRNA (RT-qPCR) and protein (Western blot, immunohistochemistry) expression

    • Include temporal analysis during sexual development

  • Functional Studies in Primary Cultures:

    • Isolate primary spermatogenic cells from bulls

    • Manipulate SPATA9 expression through knockdown or overexpression

    • Assess impact on cell differentiation, survival, and function

  • Multi-omics Integration:

    • Correlate SPATA9 expression with global transcriptomic and proteomic profiles

    • Identify co-expressed genes and pathways

Drawing from studies of similar proteins, researchers should consider that SPATA9, like PRAMEY, may be localized to specific subcellular structures and could participate in processes critical for sperm development and function .

What advanced imaging techniques are most appropriate for studying SPATA9 localization at subcellular resolution?

To achieve high-resolution mapping of SPATA9 localization, researchers should employ:

  • Super-resolution Microscopy:

    • Structured Illumination Microscopy (SIM): 2x resolution improvement over conventional microscopy

    • Stimulated Emission Depletion (STED): Resolution down to 30-80 nm

    • Single Molecule Localization Microscopy (STORM/PALM): Nanometer precision for single-molecule localization

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence localization with ultrastructural context

    • Particularly valuable for structures like the acrosome and developing flagellum

  • Immunogold Electron Microscopy:

    • Precise localization at the ultrastructural level

    • Especially useful for membrane-associated or organelle-specific proteins

    • Similar approaches have localized PRAMEY to specific organelles including the nucleus, rough endoplasmic reticulum, small vesicles, intermitochondrial cement, chromatoid body, and centrioles

  • Live-cell Imaging Approaches:

    • SPATA9-fluorescent protein fusions for dynamic localization studies

    • Photoactivatable or photoconvertible tags for pulse-chase experiments

    • Light-sheet microscopy for reduced phototoxicity in long-term imaging

These techniques should be selected based on the specific research question, with consideration for sample preparation requirements and available facilities. Integration of multiple imaging modalities provides the most comprehensive view of protein localization and dynamics.

What are the critical experimental controls for studies involving recombinant SPATA9?

Robust experimental design for SPATA9 research requires meticulous attention to controls:

  • Expression and Purification Controls:

    • Empty vector expression control

    • Unrelated protein expressed under identical conditions

    • Tag-only expression control when using tagged constructs

  • Functional Assay Controls:

    • Positive control: Well-characterized protein with similar function

    • Negative control: Protein known not to function in the pathway of interest

    • Dose-response validation to confirm specificity

  • Antibody Specificity Controls:

    • Pre-immune serum control

    • Peptide competition assay

    • Secondary antibody-only control

    • Non-expressing tissue or knockdown samples

  • Localization Study Controls:

    • Co-staining with established markers for subcellular structures

    • Comparison with proteins of known localization pattern

    • Multiple fixation and permeabilization methods to confirm patterns

When designing experiments, researchers should consider the level of abstraction and detail appropriate for their specific research questions, as this can affect experimental control and generalizability of results .

How should researchers approach data contradictions in SPATA9 studies?

When encountering contradictory data regarding SPATA9:

  • Systematic Evaluation:

    • Compare experimental methodologies in detail

    • Assess antibody specificity and validation approaches

    • Evaluate expression systems and constructs used

  • Resolution Strategies:

    • Employ multiple, complementary techniques to address the same question

    • Consider developmental timing and tissue-specific differences

    • Assess potential post-translational modifications or isoforms

  • Collaborative Verification:

    • Engage with other laboratories for independent replication

    • Exchange reagents and protocols to identify variables

    • Consider multi-laboratory studies for controversial findings

  • Contextual Interpretation:

    • Apparent contradictions may reflect biological complexity

    • Consider species differences, developmental stage variations, or environmental factors

    • Evaluate whether contradictions reflect technical limitations or genuine biological variability

A structured approach to resolving data contradictions enhances reproducibility and advances understanding of SPATA9 biology.

What emerging technologies might advance our understanding of SPATA9 function?

Several cutting-edge technologies hold promise for SPATA9 research:

  • CRISPR-based Approaches:

    • Precise genome editing for functional studies

    • CRISPRi/CRISPRa for modulating expression without genetic modification

    • Base editing for introducing specific mutations

  • Single-cell Technologies:

    • scRNA-seq to map expression across spermatogenic cell populations

    • Spatial transcriptomics to preserve tissue context

    • Single-cell proteomics for protein-level analysis

  • Protein Structure Determination:

    • Cryo-EM for high-resolution structural analysis

    • AlphaFold2-based structure prediction as a starting point for functional hypotheses

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

  • Organoid and Advanced Culture Systems:

    • Testicular organoids to model spermatogenesis in vitro

    • Microfluidic systems to study cell-cell interactions

    • Organ-on-chip technologies for physiologically relevant conditions

These technologies, when applied to SPATA9 research, may reveal previously unappreciated aspects of its function and regulation during spermatogenesis.

How might researchers integrate SPATA9 studies with broader reproductive biology research?

To contextualize SPATA9 within reproductive biology:

  • Comparative Studies Across Species:

    • Evolutionary analysis of SPATA9 conservation and divergence

    • Functional comparison in model organisms

    • Investigation of species-specific adaptations

  • Integration with Reproductive Disorders Research:

    • Screen for SPATA9 variants in infertile males

    • Assess correlation with specific pathological features

    • Evaluate potential as a diagnostic or prognostic marker

  • Systems Biology Approaches:

    • Network analysis to place SPATA9 in spermatogenesis pathways

    • Multi-omics integration for comprehensive understanding

    • Mathematical modeling of spermatogenesis incorporating SPATA9 function

  • Translational Applications:

    • Assessment as a target for male contraception

    • Evaluation as a fertility biomarker in animal breeding

    • Development of diagnostic tools for reproductive medicine

By connecting SPATA9 research to broader questions in reproductive biology, researchers can enhance the impact and relevance of their findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.