Recombinant Bovine Sphingosine 1-phosphate receptor 1 (S1PR1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Characteristics

S1PR1 is a 382-amino-acid transmembrane protein with a molecular mass of ~42.8 kDa . Key structural features include:

FeatureDetail
Gene LocationChromosome 1p21 (human homolog)
Ligand BindingHigh affinity for S1P
DomainsSeven transmembrane helices, intracellular C-terminal signaling domain
Expression SystemsMammalian cells (e.g., HEK293) for functional GPCR studies

Recombinant bovine S1PR1 retains conserved residues critical for S1P binding and downstream signaling, such as the DRY motif in transmembrane domain 3 .

Signaling Pathways and Mechanisms

S1PR1 activation triggers distinct pathways depending on cellular context:

Primary Pathways

  • Gαi/o-Dependent Signaling:

    • Inhibits adenylyl cyclase, reducing cAMP levels .

    • Activates ERK1/2 and PI3K/AKT, promoting cell survival and Mcl-1 upregulation .

  • β-Arrestin-Biased Signaling:

    • Regulates receptor internalization and NFκB/glucocorticoid receptor-mediated anti-inflammatory responses .

Cross-Talk with Other Receptors

  • Reciprocally regulates β1-adrenergic receptor (β1AR) trafficking and activity in cardiac cells .

Research Applications and Therapeutic Findings

Recombinant S1PR1 is pivotal in studying endothelial dysfunction and inflammatory diseases:

Key Studies

  • Endothelial Barrier Protection:

    • Recombinant S1PR1 agonists (e.g., SAR247799) reduced vascular leak in colitis models by stabilizing endothelial junctions .

    • Enhanced Mcl-1 expression suppressed caspase-3 cleavage, delaying apoptosis .

  • Retinopathy of Prematurity:

    • Systemic delivery of recombinant S1PR1 chaperones inhibited pathological neovascularization in murine models .

Therapeutic TargetOutcomeCitation
Inflammatory Bowel DiseaseImproved endothelial barrier integrity
Ischemic RetinopathyReduced vascular tuft formation
Heart FailureCounteracted β1AR overstimulation

Challenges and Future Directions

While recombinant bovine S1PR1 is not explicitly detailed in current literature, interspecies homology supports its utility in translational research. Ongoing efforts focus on:

  • Developing biased agonists to selectively activate Gαi/o or β-arrestin pathways .

  • Engineering thermostable mutants for crystallization studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing the order, and we will prepare it accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
S1PR1; EDG1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1; CD antigen CD363
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MGSTRIPLVKALHSPVSDYVNYDIIVRHYNYTGKLKISADKDNGIKLISVVFILICCFII LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNRFRSFLLISACWVISLILGGLPIM GWNCISTLPSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLGVFIACWAPLFILLLLDVGCKVKTCDILFRTEYFLVLA VLNSGTNPIIYTLSNKEMRRAFVRIMSCCKCPSRDSASKFTRPIIAGMEFSRSKSDNSSH PQKDDGDNPETIMSSGNVNSSS
Uniprot No.

Target Background

Function
This G-protein coupled receptor binds the bioactive lysosphingolipid sphingosine 1-phosphate (S1P), likely coupling to the G(i) subclass of heteromeric G proteins. Signaling triggers the activation of RAC1, SRC, PTK2/FAK1, and MAP kinases. It plays a crucial role in cell migration, potentially through its involvement in reorganizing the actin cytoskeleton and forming lamellipodia in response to stimuli that enhance sphingosine kinase SPHK1 activity. It is essential for normal chemotaxis towards sphingosine 1-phosphate. This receptor is also vital for normal embryonic heart development and cardiac morphogenesis. It plays a significant role in regulating sprouting angiogenesis and vascular maturation, inhibiting excessive sprouting during blood vessel development. Additionally, it is required for the normal egress of mature T-cells from the thymus into the bloodstream and peripheral lymphoid organs. It contributes to the migration of osteoclast precursor cells, regulation of bone mineralization, and bone homeostasis. Further, it participates in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in protecting against ventilator-induced lung injury.
Gene References Into Functions
  1. Research suggests inter-allelic interactions among genes influencing beef marbling development. PMID: 24033432
  2. Polymorphisms in promoter regions of PDHB, SORBS1, and EDG1 genes demonstrate marbling-associated expression changes. PMID: 21469508
  3. Two novel SNPs, g.1475435G>A and g.1471620G>T, were identified in the 5' flanking region of the EDG1 gene between low-marbled and high-marbled steer groups. PMID: 20163611
  4. Induction by vascular endothelial growth factors in endothelial cells. PMID: 12963813
  5. While not considered a causal mutation, EDG1 SNPs may serve as useful markers for marker-assisted selection to increase marbling levels in Japanese Black beef cattle. PMID: 19133939

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome. Membrane raft.

Q&A

What is the structure and function of S1PR1 in bovine tissues?

S1PR1 is a G-protein-coupled receptor expressed predominantly in endothelial cells, T cells, and other cell types. In bovine tissues, it shares high sequence homology with human and mouse variants. The receptor consists of seven transmembrane domains with an extracellular N-terminus and intracellular C-terminus domain. Functionally, S1PR1 primarily couples to Gi proteins and regulates critical cellular processes including cell migration, proliferation, and barrier integrity .

When expressing recombinant bovine S1PR1, it's important to note that the receptor maintains its natural folding only when expressed in eukaryotic systems that allow proper post-translational modifications. Studies have demonstrated that S1PR1 plays crucial roles in regulating endothelial barrier function, immune cell trafficking, and vascular development .

What are the recommended expression systems for producing recombinant bovine S1PR1?

For successful expression of functional recombinant bovine S1PR1, eukaryotic expression systems are strongly preferred over prokaryotic systems. Yeast expression systems, particularly Pichia pastoris, have demonstrated effectiveness in producing properly folded S1PR1 protein that maintains native conformational epitopes . This approach was successfully employed in developing monoclonal antibodies against S1PR1, where properly folded protein was essential for immunization .

For mammalian expression, HEK293 or CHO cell lines typically yield properly folded receptor with appropriate post-translational modifications. When designing expression constructs, consider:

Expression SystemAdvantagesDisadvantagesYield
Pichia pastorisCost-effective, post-translational modifications, high density cultureGlycosylation patterns differ from mammalian cellsModerate to high
HEK293 cellsMammalian post-translational modifications, proper foldingHigher cost, lower cell densityModerate
CHO cellsStable cell lines, scaled productionTime-consuming cell line developmentHigh for stable lines
Insect cellsHigher yields than mammalian cellsDifferent glycosylation patternsHigh

Regardless of the expression system chosen, include appropriate purification tags that won't interfere with receptor functionality, and validate protein folding using functional assays like ligand binding .

How can I verify the functionality of recombinant bovine S1PR1?

Verifying the functionality of recombinant bovine S1PR1 requires multiple complementary approaches. First, establish ligand binding capacity using radiolabeled or fluorescently labeled S1P or synthetic agonists. Competition binding assays can determine affinity constants .

Second, assess Gi protein coupling using GTPγS binding assays or downstream signaling measurements. For instance, S1PR1 activation typically leads to Akt phosphorylation, which can be measured by Western blotting . Additionally, S1PR1 functionality can be verified through receptor internalization assays using confocal microscopy - properly functioning S1PR1 should internalize upon stimulation with S1P or FTY720-P .

A recommended validation protocol includes:

  • Binding assays with S1P or synthetic ligands

  • Measurement of downstream signaling (Akt phosphorylation)

  • Receptor internalization assays using imaging techniques

  • Functional readouts specific to endothelial cells, such as barrier integrity or migration assays

How does S1PR1 interact with other G-protein coupled receptors in cardiovascular research models?

S1PR1 exhibits significant cross-talk with other GPCRs in cardiovascular systems, most notably with β1-adrenergic receptors (β1AR). Research has revealed a direct and GRK2-dependent interaction between β1AR and S1PR1 that has profound physiological implications for cardiac function . This interaction appears bidirectional, with reciprocal downregulation occurring between these receptors that impacts cardiac hypertrophy, apoptosis, and remodeling processes .

In experimental cardiovascular models, researchers have observed that:

  • Chronic heart failure leads to upregulation of G-protein-coupled receptor kinase 2 (GRK2), which contributes to β-adrenergic receptor downregulation and desensitization

  • This β-adrenergic receptor dysregulation corresponds with loss of inotropic reserve in failing myocardium

  • S1PR1 downregulation worsens left ventricular dysfunction in established myocardial damage models

These interactions suggest that when designing experiments with recombinant bovine S1PR1, researchers should consider potential cross-talk with β1AR, especially in cardiovascular research contexts. Experimental designs should include controls that account for this interaction, such as selective blocking of either receptor to isolate specific signaling pathways .

What role does recombinant S1PR1 play in studying endothelial barrier function and vascular leak?

Recombinant S1PR1 has become instrumental in deciphering the molecular mechanisms underlying endothelial barrier integrity and vascular leak. Studies utilizing S1PR1 overexpression and knockout models have demonstrated that endothelial S1PR1 signaling protects against pathological retinal vascular leak and angiogenesis . Specifically, S1PR1 activation in endothelial cells restrains the development of pathological angiogenesis by reducing VEGF-induced neovascular tufts in oxygen-induced retinopathy models .

When using recombinant bovine S1PR1 to study barrier function:

  • Compare Gi-biased agonists (like SAR247799) versus full agonists to distinguish pathway-specific effects

  • Monitor changes in tight junction proteins (ZO-1, claudins) and adherens junction proteins (VE-cadherin)

  • Implement transendothelial electrical resistance (TEER) measurements for real-time barrier function analysis

  • Conduct in vitro permeability assays using fluorescently-labeled dextrans of various molecular weights

Recent structural studies of the S1PR1-Gi signaling complex at 3.47 Å resolution revealed the recognition mode for biased ligands, offering mechanistic insights into how specific S1PR1 activation patterns can selectively enhance endothelial barrier function without affecting immune cell egress . This has profound implications for developing targeted therapies for endothelial dysfunction-associated diseases .

How can recombinant S1PR1 be utilized in studying the immunomodulatory effects in tumor microenvironments?

Recombinant S1PR1 serves as a valuable tool for investigating the complex immunomodulatory functions within tumor microenvironments. Research has revealed that S1PR1 signaling in T cells drives regulatory T cell (Treg) accumulation in tumors, limits CD8+ T cell recruitment and activation, and ultimately promotes tumor growth . These findings highlight the potential of S1PR1 as a target for cancer immunotherapy.

When designing experiments to study immunomodulatory effects:

  • Expression system considerations: The recombinant protein should maintain native conformation to accurately mimic physiological interactions. Mammalian expression systems are preferred for immunological studies.

  • Genetic manipulation approaches: Studies using T cell-specific S1PR1-deficient mice (S1pr1^-/-^) showed dramatic reduction of Tregs in tumors, while T cell S1PR1-transgenic mice (S1pr1-Tg) exhibited enhanced Treg accumulation in tumors . This bidirectional manipulation reveals S1PR1's critical role in T cell trafficking to tumors.

  • Treg quantification protocols: When assessing Treg populations, analyze:

Tissue CompartmentEffect of S1PR1 DeficiencyEffect of S1PR1 Overexpression
TumorSignificant Treg reductionEnhanced Treg accumulation
SpleenIncreased Foxp3+ TregsSlight increase in Tregs
Tumor-draining lymph nodesIncreased Foxp3+ TregsLittle effect on Treg numbers
  • Flow cytometry panel design: Include markers for Tregs (CD4+, Foxp3+, CD25+) alongside S1PR1 expression analysis to correlate receptor levels with functional phenotypes .

These approaches provide mechanistic insights into how S1PR1 regulates immune cell trafficking and function within the tumor microenvironment, offering potential therapeutic strategies targeting this pathway.

What are the optimal detection methods for recombinant bovine S1PR1 in different experimental systems?

Detection of recombinant bovine S1PR1 requires tailored approaches depending on the experimental context. For antibody-based detection, monoclonal antibodies specifically recognizing S1PR1 are recommended for their consistency and specificity. The development of monoclonal antibody clone 2B9, which recognizes an epitope on the intracellular domain of S1PR1, represents a significant advancement in detection tools .

For Western blotting applications, sample preparation is critical. Membrane proteins like S1PR1 require appropriate detergent-based extraction (typically 1% Triton X-100 or NP-40), careful temperature control (avoid boiling, which can cause aggregation), and inclusion of phosphatase inhibitors to preserve phosphorylation states .

Immunofluorescence detection benefits from fixation optimization:

Fixation MethodAdvantagesDisadvantagesRecommended for
Paraformaldehyde (4%)Preserves epitope accessibilityMay require permeabilizationMost applications
MethanolCombined fixation/permeabilizationMay denature some epitopesDetection of intracellular epitopes
GlutaraldehydeStrong crosslinkingMay reduce antibody accessibilityElectron microscopy studies

For flow cytometry detection, careful optimization of staining protocols is essential. When using commercial antibodies against human or mouse S1PR1, cross-reactivity with bovine S1PR1 should be validated. Surface versus total S1PR1 staining protocols should be developed to distinguish receptor localization .

How should receptor internalization assays be designed to study S1PR1 trafficking?

Receptor internalization assays are crucial for studying S1PR1 dynamics and signaling regulation. When designing these assays for recombinant bovine S1PR1, several methodological considerations are important.

For live-cell imaging approaches:

  • Express fluorescently-tagged S1PR1 (C-terminal tags are preferred to avoid interference with ligand binding)

  • Establish baseline membrane localization before stimulation

  • Add S1P (physiological ligand) or FTY720-P (functional antagonist causing internalization) at appropriate concentrations (typically 100nM-1μM)

  • Image at defined intervals (0, 5, 15, 30, 60 minutes) to capture internalization kinetics

  • Include appropriate controls (vehicle, receptor mutants deficient in internalization)

Alternative quantitative approaches include flow cytometry-based internalization assays, which can provide population-level data on receptor trafficking. In these assays, surface S1PR1 is labeled before and after stimulation, allowing measurement of internalization rates across cell populations .

Biochemical fractionation approaches complement imaging studies by separating plasma membrane fractions from endosomal compartments, followed by Western blotting to quantify receptor translocation between compartments. These assays should include markers for plasma membrane (Na+/K+ ATPase) and endosomal compartments (Rab5, EEA1) to verify fractionation quality .

What considerations are important when designing experiments to study S1PR1-mediated transendothelial transport?

Designing robust experiments to study S1PR1-mediated transendothelial transport requires careful methodological planning. S1PR1 activation appears to enhance transendothelial HDL transport through a mechanism involving increased cell surface abundance of SR-BI, similar to the activation of S1P1 by S1P or VEGF receptor 2 by VEGF-A .

When establishing transendothelial transport models:

  • Endothelial cell selection: Primary human aortic endothelial cells (HAECs) or bovine aortic endothelial cells (BAECs) grown to confluence on permeable supports create physiologically relevant barriers. Cell passage number should be controlled (typically <P8) to maintain stable phenotypes .

  • Transwell setup optimization:

    • Pore size: 0.4-3.0 μm depending on experimental questions

    • Coating: Fibronectin or collagen to promote endothelial attachment

    • TEER measurements: Verify barrier integrity before experiments

    • Permeability controls: Include FITC-dextran to monitor barrier function

  • Selective pathway manipulation:

    • Pharmacological approach: Compare selective S1PR1 and S1PR3 agonists/antagonists

    • Genetic approach: Use siRNA knockdown of S1PR1 and related receptors

    • Control for off-target effects: Include scrambled siRNA controls

  • Lipoprotein preparation:

    • Use fluorescently-labeled HDL (typically DiI or Alexa Fluor labeled)

    • Include size exclusion chromatography to ensure homogeneity

    • Verify functional capacity through cholesterol efflux assays

When interpreting results, consider that S1PR1 and S1PR3 may have overlapping functions in transport regulation. Interference with SR-BI abrogates enhanced binding, uptake, and transport of HDL elicited by S1P receptor agonists, suggesting mechanistic convergence on this pathway .

What are the common pitfalls in S1PR1 expression studies and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant bovine S1PR1. These pitfalls and their solutions include:

  • Low expression levels: S1PR1, like many GPCRs, often expresses poorly in heterologous systems. To address this:

    • Use codon-optimized sequences for the expression host

    • Include molecular chaperones like GRP78/BiP as co-expression partners

    • Consider fusion partners that enhance expression (e.g., BRIL, T4 lysozyme) while maintaining function

    • Implement inducible expression systems with careful optimization of induction conditions

  • Receptor misfolding: Improper folding leads to non-functional receptors that may aggregate in expression systems:

    • Reduce expression temperature (28-30°C instead of 37°C for mammalian cells)

    • Add chemical chaperones to media (e.g., 4-phenylbutyrate, DMSO at low concentrations)

    • Validate folding using conformation-sensitive approaches like binding of conformation-specific antibodies

  • Antibody cross-reactivity: Many commercial antibodies show poor specificity:

    • Validate antibody specificity using S1PR1 knockout/knockdown controls

    • Use multiple antibodies targeting different epitopes

    • Consider epitope-tagged constructs when appropriate

    • Loss of antibody signal upon knockdown of endogenous S1PR1 confirms specificity

  • Variable glycosylation: Different expression systems produce varying glycosylation patterns:

    • Characterize glycosylation status by glycosidase treatment

    • Consider enzymatic deglycosylation for applications where homogeneity is critical

    • Select expression systems based on glycosylation requirements

Implementing these solutions helps ensure that studies with recombinant bovine S1PR1 produce reliable, reproducible results that accurately reflect the receptor's native properties and functions.

How can conflicting data on S1PR1 signaling pathways be reconciled in experimental models?

Reconciling conflicting data on S1PR1 signaling often requires careful consideration of experimental contexts. Several strategies can help address apparently contradictory findings:

  • Cell type-specific signaling: S1PR1 exhibits distinct signaling patterns across cell types. For example:

    • In endothelial cells, S1PR1 predominantly signals through Gi to enhance barrier function

    • In T cells, S1PR1 signaling drives lymphocyte egress and influences Treg accumulation

    • In cardiomyocytes, S1PR1 interacts with β1-adrenergic receptor in a GRK2-dependent manner

    When comparing studies, carefully note cell types used and consider performing parallel experiments in different cell types relevant to your research question.

  • Agonist-specific effects: Different S1PR1 ligands can produce distinct signaling profiles:

    • Natural ligand (S1P) activates multiple downstream pathways

    • Biased agonists (like SAR247799) selectively activate Gi-coupled pathways

    • Functional antagonists (FTY720-P) cause receptor internalization

    Standardize ligand selection across experiments when comparing signaling outcomes.

  • Receptor expression levels: Overexpression systems may show different signaling patterns than endogenous systems:

    • High overexpression can lead to constitutive activity

    • Endogenous expression levels preserve normal feedback mechanisms

    • Use inducible expression systems to titrate receptor levels

  • Genetic background considerations: Knockout/transgenic models may have compensatory mechanisms:

    • S1PR1 knockout mice show systemic lymphopenia affecting multiple pathways

    • S1PR1-transgenic models may have altered receptor trafficking dynamics

    • Consider using acute interventions (siRNA, CRISPR, pharmacological) alongside genetic models

By systematically addressing these variables, researchers can often reconcile apparently conflicting data and develop a more nuanced understanding of S1PR1 signaling across different physiological and pathological contexts.

What statistical approaches are most appropriate for analyzing S1PR1 functional studies?

Selecting appropriate statistical methods for S1PR1 functional studies depends on the experimental design and data characteristics. Several recommended approaches include:

  • For receptor binding studies:

    • Nonlinear regression analysis for saturation binding curves

    • Calculation of Kd, Bmax using one-site or two-site binding models

    • For competition binding, IC50 conversion to Ki using Cheng-Prusoff equation

    • Present binding data as Scatchard plots to identify potential binding site heterogeneity

  • For signaling pathway activation:

    • Time-course experiments: Repeated measures ANOVA with appropriate post-hoc tests

    • Dose-response curves: Four-parameter logistic regression to determine EC50 values

    • Western blot quantification: Normalization to loading controls with appropriate paired tests

    • Consider area-under-curve analysis for transient signaling responses

  • For functional outcomes in disease models:

    • Animal models (e.g., OIR model): Power analysis to determine appropriate sample sizes

    • For studies comparing WT, knockout, and transgenic animals: One-way ANOVA with post-hoc tests

    • For longitudinal studies: Mixed-effects models to account for repeated measures

  • For transendothelial transport experiments:

    • Multiple timepoint measures: Two-way ANOVA with time and treatment as factors

    • Account for potential confounding variables like cell passage number using ANCOVA

    • Use correlation analysis to relate receptor expression levels to transport efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.