Recombinant Bovine Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (NSDHL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NSDHL; Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
NSDHL
Target Protein Sequence
MEQAAGEPTRTCLTEDIPKAKRCTVIGGCGFLGQHMVEQLLARGYAVNVFDIRQGFDNPR VQFFLGDLCSQQDLYPALKGVSTVFHCASPPPFNNNKELFYRVNYIGTKNVIETCKEAGV QKLILTSSASVIFEGVDIKNGTEDLPYATKPIDYYTETKILQERAVLGAHDPEKNFLTTA IRPHGIFGPRDPQLVPILIEAAKKGKMKFMIGNGKNLVDFTFVENVVHGHILAAEHLSQD TALGGKAFHITNDEPIPFWTFLSRILTGLNYEAPKYHIPYWLAYYLALLVSLLVMVISPV IQLQPTFTPMRVALAGTFHYYSCEKAKKLMGYRPLVTMDDAVDKTVRSFHHLRKVM
Uniprot No.

Target Background

Function

This enzyme catalyzes the NAD(P)(+)-dependent oxidative decarboxylation of the C4 methyl groups of 4-alpha-carboxysterols within the post-squalene cholesterol biosynthesis pathway. It also plays a regulatory role in EGFR endocytic trafficking.

Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Lipid droplet.

Q&A

What is the primary function of NSDHL in cholesterol biosynthesis?

NSDHL (NAD(P) dependent steroid dehydrogenase-like) functions as a critical enzyme in the post-squalene cholesterol biosynthesis pathway. Specifically, NSDHL catalyzes the NAD+-dependent oxidative decarboxylation of the C4 methyl groups of 4α-carboxysterols . This decarboxylation step is essential for the proper formation of the sterol ring structure during cholesterol synthesis. The enzyme is primarily localized in the endoplasmic reticulum (ER) membrane, where most cholesterol biosynthetic reactions occur, as well as in lipid droplets, which are ER-derived cytoplasmic structures for storing lipids and cholesterols . This subcellular localization is critical for its function, as it positions NSDHL within the cellular architecture to efficiently participate in the multi-step process of cholesterol synthesis.

What is the molecular structure of bovine NSDHL and how does it compare to human NSDHL?

Bovine NSDHL shares significant structural homology with human NSDHL, which has been characterized through X-ray crystallography. Human NSDHL crystal structures reveal detailed information about the coenzyme-binding site and the conformational changes that occur upon coenzyme binding . The enzyme exists in both apo (unbound) and holo (coenzyme-bound) forms, with notable conformational differences between these states. While specific bovine NSDHL crystal structures have not been extensively documented in the provided search results, the high conservation of this enzyme across mammalian species suggests similar structural characteristics. The human enzyme structure, determined using molecular replacement methods with GOX2253 from Gluconobacter oxydans as a search model, provides a framework for understanding bovine NSDHL structure through comparative analysis .

Which biochemical pathways involve NSDHL beyond cholesterol biosynthesis?

While NSDHL is primarily associated with the steroid biosynthesis pathway, it also participates in broader metabolic networks. According to pathway analyses, NSDHL is involved in multiple metabolic pathways beyond steroid biosynthesis . The enzyme interacts with various proteins in these pathways, including SQLE, SOAT1, FDFT1, SOAT2, FAXDC2, CYP51, DHCR24, TM7SF2, SQLEA, and CELL in the steroid biosynthesis pathway . Additionally, NSDHL functions in broader metabolic networks that include proteins such as DPAGT1, IMPDH2, B3GNT5B, GCNT4A, GCSH, ALDH2, PGM3, AGXT2L1, SMPD4, and ALOX5A . These interactions highlight NSDHL's role as an integrator of sterol metabolism with other cellular processes.

What enzymatic activities does NSDHL exhibit?

NSDHL demonstrates several distinct enzymatic activities, with the primary ones being:

  • Sterol-4-alpha-carboxylate 3-dehydrogenase (decarboxylating) activity - The main catalytic function enabling the removal of carboxyl groups from sterol intermediates .

  • 3-beta-hydroxy-delta5-steroid dehydrogenase activity - An activity shared with other dehydrogenases in the steroid biosynthesis pathway .

These enzymatic capabilities enable NSDHL to perform its critical functions in cholesterol biosynthesis. The enzyme functions in conjunction with other proteins sharing similar activities, including HSD3B5, HSD3B1, SDR42E1, HSD3B4, HSD3B6, HSD3B2, and HSD3B7 . The 3-beta-hydroxy-delta5-steroid dehydrogenase activity in particular represents a biochemical function that positions NSDHL within the larger family of steroid dehydrogenases.

What are the optimal methods for expressing and purifying recombinant bovine NSDHL?

For optimal expression and purification of recombinant bovine NSDHL, researchers should consider a multi-step approach based on protocols established for human NSDHL. The gene encoding NSDHL should be cloned into a suitable expression vector containing appropriate purification tags (such as His-tag). Expression in E. coli or mammalian cell systems (particularly HEK293 cells) has proven effective for recombinant NSDHL production .

For purification, a combination of affinity chromatography (using His-tag or GST-tag depending on the construct), followed by size-exclusion chromatography, yields highly pure protein. Based on protocols used for human NSDHL, researchers should:

  • Express the protein in E. coli BL21(DE3) cells with induction at OD600 of 0.6-0.8 using IPTG

  • Lyse cells in buffer containing 50 mM HEPES (pH 8.0), 500 mM NaCl, and protease inhibitors

  • Purify using Ni-NTA affinity chromatography with imidazole gradient elution

  • Perform further purification via size-exclusion chromatography using a Superdex 200 column

The addition of 20% glycerol to all buffers helps maintain protein stability throughout the purification process .

What assays can be used to measure NSDHL enzymatic activity?

Several complementary approaches can be employed to measure NSDHL enzymatic activity:

  • Spectrophotometric NAD(P)H Fluorescence Assay: This technique measures the fluorescence intensity change of NAD(P)H (Ex/Em = 340/460 nm) as it is consumed during the enzymatic reaction. The assay is typically performed in a total volume of 100 μl in 96-well flat-bottom black microplates using 32 μM NSDHL in assay buffer (50 mM HEPES (pH 8.0), 20% (v/v) glycerol) with 80 μM NADH .

  • Isothermal Titration Calorimetry (ITC): This method determines the binding affinity of NSDHL for different coenzymes (NAD+, NADH, NADP+, and NADPH). The typical protocol uses an initial injection volume of 0.4 μl followed by 20 identical 2 μl injections with a 5 s delay time per injection and intervals of 150 s between injections .

  • Thermal Shift Assay (TSA): This technique assesses protein stability and can be used to evaluate the impact of mutations or inhibitors on NSDHL. The assay is performed with protein solutions diluted to 5 μM concentration with SYPRO Orange as the fluorescent dye, measuring fluorescence as temperature increases from 25 to 95°C at a rate of 1°C/min .

Data analysis for these assays typically involves calculating IC50 values, binding constants (K), changes in enthalpy (ΔH), and melting temperatures (Tm), providing comprehensive characterization of NSDHL enzymatic properties and interactions.

How can researchers effectively design mutations to study NSDHL structure-function relationships?

Effective mutation design for studying NSDHL structure-function relationships should be guided by crystal structure information and evolutionary conservation analysis. Based on the available structural data for human NSDHL, researchers should focus on:

  • Coenzyme-binding site residues: Crystal structures of human NSDHL reveal detailed information about the coenzyme-binding pocket . Mutations of residues in this region can help elucidate the mechanism of coenzyme binding and catalysis.

  • Known pathogenic mutations: Mutations associated with CHILD syndrome and other disorders provide natural probes for structure-function studies. The G205S and K232Δ mutations have been specifically characterized using thermal shift assays to assess their impact on protein stability .

  • Conserved residues across species: Alignment of bovine and human NSDHL sequences can identify highly conserved amino acids that are likely functionally important.

For experimental validation, thermal shift assays (TSA) have proven effective in assessing the impact of mutations on NSDHL stability. Wild-type NSDHL and mutant variants should be analyzed at 5 μM concentration with SYPRO Orange dye, measuring the melting temperature (Tm) as described in the literature . Functional assays measuring enzymatic activity should complement stability studies to provide a comprehensive understanding of how structural changes affect function.

What experimental approaches can be used to study NSDHL interactions with other proteins in the cholesterol biosynthesis pathway?

To investigate NSDHL interactions with other proteins in the cholesterol biosynthesis pathway, researchers should employ multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): This technique can identify direct protein-protein interactions between NSDHL and other pathway components. Antibodies against NSDHL or epitope tags (if using recombinant proteins) can pull down protein complexes from cellular lysates.

  • Size-exclusion chromatography with multiangle light scattering (SEC-MALS): This approach has been successfully used to analyze NSDHL oligomerization states and can be adapted to study complex formation with other proteins. The method involves using a Superdex 200 10/300 GL gel filtration column pre-equilibrated with appropriate buffer (e.g., 50 mM HEPES, 500 mM NaCl, pH 8.0) .

  • Proximity labeling techniques: Methods such as BioID or APEX2 can identify proximal proteins in the cellular context, providing insights into the broader interactome of NSDHL within the endoplasmic reticulum.

  • Gene expression correlation analysis: Microarray analysis comparing gene expression in cells with mutant versus wild-type NSDHL has revealed pathways affected by NSDHL function . Similar approaches can identify co-regulated genes and potential interacting partners.

For data analysis and validation, researchers should consider using pathway enrichment tools to place identified interactions in the context of known cholesterol biosynthesis networks, as exemplified by the KEGG pathway analysis showing NSDHL's involvement with SQLE, SOAT1, FDFT1, and other proteins .

How does NSDHL contribute to EGFR signaling regulation and cancer progression?

NSDHL plays a crucial role in regulating epidermal growth factor receptor (EGFR) signaling through multiple mechanisms:

  • EGFR protein turnover regulation: NSDHL affects EGFR protein stability and trafficking. Inhibition of NSDHL alters EGFR protein turnover, suggesting a direct link between cholesterol metabolism and receptor dynamics .

  • Sensitization to EGFR inhibitors: Loss of NSDHL gene expression has been shown to sensitize cancer cells to EGFR-targeting inhibitors. This suggests that NSDHL may modulate resistance mechanisms to targeted therapies .

  • Impact on downstream signaling pathways: NSDHL inhibition suppresses EGFR signaling cascades, leading to enhanced efficacy of erlotinib (an EGFR kinase inhibitor) in both erlotinib-sensitive and erlotinib-resistant cancer cell lines .

In breast cancer research, NSDHL knockdown has demonstrated significant anti-cancer effects:

  • Reduction in cancer stem cell populations: NSDHL knockdown reduced tightly cohesive sphere formation and decreased the population of breast cancer stem cells (BCSCs) with CD44+/CD24- phenotype and high ALDH activity .

  • Suppression of tumor initiation: In orthotropic xenograft tumor models, NSDHL knockdown strongly suppressed tumor initiation and growth, suggesting its importance in cancer development .

  • Pathway alterations: RNA-seq data revealed significant changes in gene expression following NSDHL knockdown, with differential expression of genes enriched in TGF-β signaling pathway and cell cycle regulation .

These findings highlight NSDHL as a potential therapeutic target in EGFR-driven cancers and breast cancer, connecting cholesterol metabolism to critical oncogenic signaling pathways.

What is the current understanding of NSDHL's role in developmental disorders?

NSDHL plays a critical role in embryonic development, and mutations in the NSDHL gene are associated with several developmental disorders:

  • CHILD Syndrome: Congenital hemidysplasia with ichthyosiform nevus and limb defects (CHILD) syndrome results from mutations in the X-linked NSDHL gene . This X-linked dominant disorder of lipid metabolism is characterized by disturbed cholesterol biosynthesis and is typically lethal in males . The syndrome manifests as skin and skeletal abnormalities in females in a distribution reflecting random X inactivation .

  • Murine Models of NSDHL Deficiency: The bare patches (Bpa) mice carry mutant alleles of the murine Nsdhl gene, with Bpa(1H) representing a null allele . Heterozygous Bpa(1H) females display skin and skeletal abnormalities similar to human CHILD syndrome, while hemizygous male embryos die before embryonic day 10.5, highlighting the essential role of NSDHL in early development .

  • Novel Mutations and Clinical Presentations: Recent research has identified novel mutations in the NSDHL gene in a Chinese family that resulted in recurrent male fatality . This finding expands our understanding of the spectrum of NSDHL mutations and their clinical consequences.

  • Molecular Basis of Developmental Defects: Microarray analysis comparing gene expression in embryonic fibroblasts expressing the Bpa(1H) allele versus wild-type cells has provided insights into the molecular mechanisms underlying developmental abnormalities associated with NSDHL deficiency . These studies reveal that NSDHL mutations affect multiple developmental pathways, extending beyond direct effects on cholesterol metabolism.

The embryonic lethality in male mice and the severe developmental abnormalities in heterozygous females underscore the fundamental importance of properly regulated cholesterol biosynthesis during development.

How can structural insights into NSDHL be leveraged for inhibitor development?

Structural insights into NSDHL provide valuable information for rational inhibitor design:

  • Crystal Structure Utilization: Two X-ray crystal structures of human NSDHL have revealed detailed information about the coenzyme-binding site and conformational changes upon coenzyme binding . These structures can be leveraged for structure-based virtual screening and rational drug design.

  • Active Site Targeting: Detailed knowledge of the enzyme's active site enables the design of competitive inhibitors that can interfere with substrate binding or catalytic activity. The unique conformational change observed upon coenzyme binding presents opportunities for developing inhibitors that stabilize specific enzyme conformations .

  • Virtual Screening Approaches: Structure-based virtual screening has already been successfully employed to identify novel NSDHL inhibitors. This approach involves computational docking of compound libraries against the solved crystal structures to identify candidates with favorable binding characteristics .

  • Validation and Optimization: Biochemical evaluation of potential inhibitors identified through virtual screening has led to the discovery of compound 9, which exhibited a half-maximal inhibitory concentration (IC50) of approximately 8 μM . Further optimization of this scaffold could yield more potent and selective inhibitors.

  • Functional Assessment: Beyond binding and inhibition of enzymatic activity, potential NSDHL inhibitors should be evaluated for their ability to alter EGFR protein turnover and suppress EGFR signaling cascades . This downstream functional validation ensures that inhibitors target physiologically relevant pathways.

The development of NSDHL inhibitors represents a promising therapeutic strategy against cholesterol-related diseases and cancers, particularly EGFR-driven malignancies where NSDHL inhibition may enhance the efficacy of existing kinase inhibitors.

What mechanisms connect NSDHL function to cancer stem cell maintenance?

NSDHL plays a critical role in maintaining cancer stem cell populations through several interconnected mechanisms:

  • Regulation of Breast Cancer Stem Cells (BCSCs): NSDHL knockdown reduces the population of BCSCs with CD44+/CD24- phenotype and high ALDH activity, which are established markers of breast cancer stem cells . This suggests that NSDHL is essential for maintaining the stem-like properties of these cells.

  • Impact on Luminal Progenitors: NSDHL knockdown also decreases the population of luminal progenitors with CD49f+/EpCAM+ phenotype, indicating its role in regulating differentiation hierarchies within breast cancer .

  • Modulation of Key Signaling Pathways: RNA-seq analysis of NSDHL knockdown tumorspheres revealed significant alterations in gene expression, with 253 genes upregulated and 364 genes downregulated (>2-fold change) . These differentially expressed genes were mainly enriched in the TGF-β signaling pathway and cell cycle regulation.

  • Reduction in Growth Factors: NSDHL knockdown leads to a decrease in TGF-β1 and TGF-β3 levels, as well as a reduction in GLI1 expression in tumorspheres . These factors are critical regulators of stemness and self-renewal in cancer stem cells.

  • Suppression of Tumor Initiation: In orthotropic xenograft tumor models, NSDHL knockdown strongly suppressed tumor initiation and growth, suggesting that its role in maintaining cancer stem cells directly impacts tumorigenesis .

These findings collectively establish NSDHL as a key regulator of cancer stem cell maintenance and tumor initiation, highlighting its potential as a therapeutic target for preventing breast cancer initiation and progression through elimination of the cancer stem cell population.

What are common challenges in producing active recombinant bovine NSDHL and how can they be addressed?

Researchers frequently encounter several challenges when producing active recombinant bovine NSDHL. These challenges and their solutions include:

  • Protein Solubility Issues:

    • Challenge: NSDHL is a membrane-associated protein that may exhibit poor solubility when expressed recombinantly.

    • Solution: Use fusion tags such as SUMO or MBP to enhance solubility, and include 20% (v/v) glycerol in all buffers as has been demonstrated effective for human NSDHL . Expression at lower temperatures (16-18°C) after induction can also improve proper folding and solubility.

  • Protein Stability Concerns:

    • Challenge: NSDHL may show decreased stability during purification and storage.

    • Solution: Thermal shift assays (TSA) can be used to screen buffer conditions that maximize protein stability . Include appropriate protease inhibitors during purification, and store the purified protein with glycerol at -80°C in small aliquots to avoid freeze-thaw cycles.

  • Maintaining Enzymatic Activity:

    • Challenge: Loss of activity during purification or storage.

    • Solution: Add reducing agents like DTT or β-mercaptoethanol to buffers to maintain the redox state of critical cysteine residues. Verify activity using spectrophotometric NAD(P)H fluorescence assays after each purification step .

  • Expression System Selection:

    • Challenge: Different expression systems yield varying levels of active protein.

    • Solution: Compare protein yield and activity from multiple expression systems (E. coli, mammalian cells, insect cells). For bovine NSDHL, both prokaryotic (E. coli) and eukaryotic (mammalian HEK293) expression systems have proven effective for recombinant production .

Size-exclusion chromatography with multiangle light scattering (SEC-MALS) can be used to verify the proper oligomeric state of the purified protein, ensuring that aggregation or improper folding has not occurred during the purification process .

How can researchers accurately interpret NSDHL activity assays and identify potential artifacts?

Accurate interpretation of NSDHL activity assays requires careful consideration of several factors to distinguish true enzymatic activity from artifacts:

  • Proper Controls for Spectrophotometric Assays:

    • Include enzyme-free negative controls to account for non-enzymatic NAD(P)H oxidation

    • Use heat-inactivated enzyme as an additional control to identify potential artifacts from other components in the enzyme preparation

    • Perform concentration-dependent assays to verify that activity scales linearly with enzyme concentration

  • Validation Through Multiple Assay Formats:

    • Cross-validate activity measurements using complementary approaches (e.g., spectrophotometric assays, ITC, and TSA)

    • If inconsistencies arise between different assay types, this may indicate interference in one assay format

  • Identification of Compound Interference:

    • When screening potential inhibitors, test compounds for intrinsic fluorescence or absorbance that might interfere with assay readout

    • Include compound-only controls (without enzyme) to identify direct effects on assay components

    • For fluorescence-based assays, measure potential inner filter effects by testing compounds at the excitation and emission wavelengths used (340/460 nm)

  • Data Analysis Considerations:

    • Use appropriate statistical methods to calculate enzyme kinetic parameters (Km, Vmax)

    • When calculating IC50 values for inhibitors, use nonlinear regression rather than linear interpolation

    • For thermal shift assays, employ Boltzmann sigmoidal fitting in software like GraphPad Prism to accurately determine melting temperature (Tm) values

  • Accounting for Protein Quality:

    • Verify protein homogeneity using SEC-MALS before activity measurements

    • Fresh preparations of enzyme typically provide more reliable results than stored samples

By implementing these guidelines, researchers can minimize artifacts and generate more reliable data when characterizing NSDHL activity and its modulation by inhibitors or mutations.

What strategies can address conflicting data between in vitro NSDHL assays and cellular studies?

Resolving discrepancies between in vitro enzymatic assays and cellular studies of NSDHL function requires a systematic approach:

  • Bridging In Vitro to Cellular Contexts:

    • Perform enzyme assays using cellular extracts in addition to purified recombinant protein

    • Develop cell-based assays that directly measure NSDHL activity, such as metabolic labeling of cholesterol intermediates

    • Use techniques like cellular thermal shift assays (CETSA) to confirm target engagement of inhibitors in the cellular environment

  • Addressing Differential Cofactor Availability:

    • In vitro NSDHL activity is dependent on NAD+/NADH availability, which may differ from cellular conditions

    • Measure cellular NAD+/NADH ratios and adjust in vitro conditions to better mimic the cellular environment

    • Test enzyme activity across a range of physiologically relevant cofactor concentrations

  • Accounting for Protein-Protein Interactions:

    • NSDHL functions within larger protein complexes in cells, which may affect its activity

    • Identify interaction partners through co-immunoprecipitation or proximity labeling

    • Reconstitute key protein complexes in vitro to better represent cellular conditions

  • Spatiotemporal Considerations:

    • NSDHL is localized to the endoplasmic reticulum membrane and lipid droplets in cells

    • Consider membrane reconstitution systems for in vitro assays to better mimic the native environment

    • Use subcellular fractionation to measure activity in relevant cellular compartments

  • Genetic Approaches for Validation:

    • Use CRISPR-Cas9 to generate NSDHL knockout or knockdown cellular models

    • Perform rescue experiments with wild-type or mutant NSDHL to validate specificity

    • Compare phenotypic effects of genetic manipulation with pharmacological inhibition

When investigating NSDHL's role in EGFR signaling and cancer, researchers have observed that NSDHL inhibition affects EGFR protein turnover and enhances the efficacy of EGFR kinase inhibitors in both erlotinib-sensitive and erlotinib-resistant cancer cell lines . If in vitro assays fail to explain these cellular effects, exploration of indirect mechanisms through metabolite profiling or unbiased proteomic approaches may help resolve discrepancies.

How can researchers effectively analyze the impact of NSDHL mutations or inhibition on cellular cholesterol homeostasis?

Comprehensive analysis of NSDHL mutations or inhibition on cellular cholesterol homeostasis requires a multi-faceted approach:

  • Sterol Intermediate Profiling:

    • Use liquid chromatography-mass spectrometry (LC-MS) to quantify sterol intermediates that accumulate due to NSDHL deficiency

    • Focus particularly on 4α-carboxysterols and other C4-methylated sterols that are direct substrates of NSDHL

    • Compare profiles from wild-type, NSDHL-mutant, and inhibitor-treated cells to identify specific blockages in the pathway

  • Total Cholesterol Measurement:

    • Employ enzymatic assays or filipin staining to quantify total cellular cholesterol

    • Fractionate cells to determine cholesterol distribution between plasma membrane and intracellular compartments

    • Use isotopic labeling (e.g., 13C-acetate) to measure de novo cholesterol synthesis rates

  • Gene Expression Analysis:

    • Conduct microarray or RNA-seq analysis comparing wild-type and NSDHL-deficient cells, as has been done with embryonic fibroblasts expressing the Bpa(1H) allele versus wild-type cells

    • Focus on genes involved in cholesterol biosynthesis, uptake, and efflux to identify compensatory mechanisms

    • Analyze SREBP pathway activation, which regulates cholesterol homeostasis

  • Functional Assessment of Cholesterol-Dependent Processes:

    • Evaluate membrane fluidity and lipid raft integrity

    • Assess receptor trafficking, particularly for EGFR which is known to be affected by NSDHL inhibition

    • Monitor signaling pathways dependent on proper cholesterol distribution

  • Integrative Data Analysis:

    • Correlate sterol profiles with gene expression changes

    • Use pathway analysis tools to identify broader metabolic adaptations

    • Develop computational models of cholesterol homeostasis that can predict the impact of NSDHL perturbation

As shown in studies of NSDHL's role in cancer, the enzyme affects not only cholesterol biosynthesis but also important signaling pathways. RNA-seq data from NSDHL knockdown experiments revealed significant changes in TGF-β signaling pathway and cell cycle regulation , indicating that the effects of NSDHL deficiency extend beyond direct impacts on cholesterol metabolism.

What are promising approaches for developing selective NSDHL inhibitors as research tools?

Several promising approaches can accelerate the development of selective NSDHL inhibitors as valuable research tools:

  • Structure-Based Drug Design:

    • Leverage the two published X-ray crystal structures of human NSDHL that reveal detailed information about the coenzyme-binding site and conformational changes upon coenzyme binding

    • Target unique structural features that distinguish NSDHL from other dehydrogenases to enhance selectivity

    • Design compounds that stabilize specific conformational states identified in structural studies

  • Fragment-Based Screening:

    • Use biophysical methods like thermal shift assays (TSA), which have already been successfully applied to NSDHL , to identify fragment hits

    • Build from fragments that bind to specific pockets identified in crystal structures

    • Employ fragment growing, linking, or merging strategies to develop more potent compounds

  • Optimization of Known Inhibitors:

    • Build upon the identified compound 9, which exhibited an IC50 of approximately 8 μM

    • Conduct structure-activity relationship studies to improve potency while maintaining selectivity

    • Incorporate cellular permeability and stability considerations into optimization efforts

  • Allosteric Inhibitor Development:

    • Target allosteric sites rather than the highly conserved active site to achieve greater selectivity

    • Identify allosteric pockets through computational pocket detection algorithms

    • Validate allosteric binding through mutations and biophysical assays

  • Targeted Covalent Inhibitors:

    • Identify accessible, non-conserved cysteine residues in NSDHL that could be targeted by covalent warheads

    • Design electrophilic compounds that selectively react with these cysteines

    • Validate specificity through proteomic approaches like activity-based protein profiling

For validation and characterization of inhibitors, researchers should implement a comprehensive panel of assays including:

  • In vitro enzymatic assays measuring NAD(P)H fluorescence (Ex/Em = 340/460 nm)

  • Cellular thermal shift assays to confirm target engagement in cells

  • Sterol profiling to verify on-target effects on cholesterol biosynthesis

  • Phenotypic assays measuring EGFR turnover and signaling to connect to downstream biological effects

How might single-cell technologies advance our understanding of NSDHL function in heterogeneous tissues?

Single-cell technologies offer powerful approaches to unravel NSDHL function in complex heterogeneous tissues:

  • Single-Cell RNA Sequencing (scRNA-seq):

    • Map cell type-specific expression patterns of NSDHL across tissues and developmental stages

    • Identify co-expressed gene networks that might functionally interact with NSDHL

    • Study compensatory transcriptional responses to NSDHL deficiency at single-cell resolution

    • Particularly valuable for studying tissues affected in CHILD syndrome, where X-inactivation creates a mosaic of NSDHL-expressing and NSDHL-deficient cells

  • Single-Cell Metabolomics:

    • Quantify sterols and cholesterol intermediates at the single-cell level

    • Correlate metabolite profiles with NSDHL expression in individual cells

    • Identify cell-specific metabolic phenotypes associated with NSDHL function or dysfunction

  • Spatial Transcriptomics and Proteomics:

    • Map NSDHL expression in the spatial context of tissues

    • Correlate NSDHL expression patterns with histopathological features in CHILD syndrome lesions

    • Investigate how NSDHL expression in one cell type affects neighboring cells through paracrine signaling

  • Single-Cell ATAC-seq and Epigenomics:

    • Study the epigenetic regulation of NSDHL expression across different cell types

    • Investigate chromatin accessibility changes in response to NSDHL deficiency

    • Identify transcription factors regulating NSDHL expression

  • Single-Cell Perturbation Screens:

    • Perform CRISPR screens with single-cell readouts to identify genetic interactions with NSDHL

    • Study how different cell types in a tissue respond to NSDHL inhibition

    • Identify cell type-specific vulnerabilities to NSDHL deficiency

These approaches are particularly relevant for studying NSDHL's role in cancer heterogeneity. Research has shown that NSDHL knockdown reduces breast cancer stem cell populations with CD44+/CD24- phenotype and high ALDH activity . Single-cell technologies could further dissect this heterogeneity to identify which specific cell subpopulations within tumors are most dependent on NSDHL function, potentially leading to more precise therapeutic strategies.

What emerging connections between NSDHL and other cellular processes warrant further investigation?

Several emerging connections between NSDHL and other cellular processes present compelling avenues for future research:

  • NSDHL and Immune System Regulation:

    • Cholesterol metabolism is increasingly recognized as a regulator of immune cell function

    • Investigate how NSDHL activity affects immune cell differentiation, activation, and effector functions

    • Explore potential applications in immuno-oncology, given NSDHL's established role in cancer

  • NSDHL in Cellular Stress Responses:

    • Examine how NSDHL function is affected by various cellular stresses (oxidative, ER, metabolic)

    • Investigate whether NSDHL inhibition sensitizes cells to specific stress conditions

    • Explore potential synthetic lethal interactions with stress response pathways

  • NSDHL in Metabolic Cross-talk:

    • Study interactions between cholesterol biosynthesis and other metabolic pathways

    • Investigate how NSDHL activity influences or is influenced by glucose metabolism, fatty acid synthesis, or amino acid metabolism

    • Explore metabolic adaptations to NSDHL inhibition

  • NSDHL in Protein Quality Control and Degradation:

    • Further examine the mechanism by which NSDHL regulates EGFR protein turnover

    • Investigate if this regulatory role extends to other receptor tyrosine kinases or membrane proteins

    • Explore connections between NSDHL and the ubiquitin-proteasome system or autophagy pathways

  • NSDHL in Development and Stem Cell Biology:

    • Build on findings related to NSDHL's role in cancer stem cells

    • Investigate its function in normal stem cell maintenance and differentiation

    • Explore developmental consequences of NSDHL deficiency beyond what's known from CHILD syndrome

RNA-seq data from NSDHL knockdown studies have already revealed unexpected connections to the TGF-β signaling pathway and cell cycle regulation . These findings suggest that NSDHL's influence extends far beyond its enzymatic role in cholesterol biosynthesis, potentially serving as an integrator of cellular metabolism with critical signaling pathways. Exploring these connections could reveal new therapeutic opportunities and fundamental insights into cellular homeostasis.

How might systems biology approaches enhance our understanding of NSDHL in the context of cellular cholesterol homeostasis?

Systems biology approaches offer powerful frameworks for understanding NSDHL's role within the complex network of cellular cholesterol homeostasis:

  • Genome-Scale Metabolic Modeling:

    • Integrate NSDHL into genome-scale metabolic models that include all cholesterol biosynthesis enzymes

    • Perform flux balance analysis to predict metabolic consequences of NSDHL perturbation

    • Identify potential compensatory pathways that may be activated upon NSDHL inhibition

    • Model how changes in NSDHL activity ripple through connected metabolic networks

  • Multi-Omics Data Integration:

    • Combine transcriptomics, proteomics, and metabolomics data from NSDHL perturbation experiments

    • Use computational approaches to identify causal relationships between changes in different molecular layers

    • Build predictive models of how NSDHL inhibition affects multiple cellular processes

    • Analyze microarray data from embryonic fibroblasts expressing mutant versus wild-type NSDHL in conjunction with other omics datasets

  • Network Analysis of Protein-Protein Interactions:

    • Map NSDHL's position within protein interaction networks

    • Identify how NSDHL connects to regulatory proteins in the cholesterol biosynthesis pathway

    • Explore interactions with proteins in the EGFR trafficking and signaling pathways

    • Construct pathway enrichment analyses similar to those revealing NSDHL's involvement with SQLE, SOAT1, FDFT1, and other proteins

  • Dynamic Modeling of Cholesterol Regulation:

    • Develop ordinary differential equation models of the cholesterol biosynthesis pathway

    • Incorporate feedback regulation through SREBP and other regulatory mechanisms

    • Simulate temporal responses to NSDHL inhibition or mutation

    • Validate model predictions through time-course experiments

  • Constraint-Based Modeling Approaches:

    • Apply methods like MOMA (Minimization of Metabolic Adjustment) to predict how cells adapt to NSDHL deficiency

    • Identify potential metabolic vulnerabilities that arise from these adaptations

    • Predict combinatorial targets that could synergize with NSDHL inhibition

These systems approaches could help explain complex phenotypes associated with NSDHL dysfunction, such as the developmental abnormalities in CHILD syndrome and the effects on cancer stem cell maintenance . By viewing NSDHL not as an isolated enzyme but as a node in an interconnected network, researchers can gain insights into its broader biological significance and identify new therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.