Recombinant Bovine Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (SDHC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SDHC; CYB560; Succinate dehydrogenase cytochrome b560 subunit, mitochondrial; Integral membrane protein CII-3; QPs-1; QPs1; Succinate dehydrogenase complex subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-169
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
LGTTAKEEMERFWSKNTTLNRPLSPHISIYGWSLPMAMSICHRGTGIALSAGVSLFGLSA LLVPGSFESHLEFVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLTISQLH QSGVAVLVLTVLSSVGLAAM
Uniprot No.

Target Background

Function

Membrane-anchoring subunit of succinate dehydrogenase (SDH), a component of mitochondrial complex II in the electron transport chain. SDHC is responsible for electron transfer from succinate to ubiquinone (coenzyme Q).

Gene References Into Functions
  1. Chromosome 2 assignment. PMID: 16717460
Database Links
Protein Families
Cytochrome b560 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does bovine SDHC contribute to electron transport in the mitochondrial respiratory chain?

Bovine SDHC, together with SDHD, forms the membrane-anchoring domain of complex II and plays a crucial role in electron transport from succinate to ubiquinone. The electron transfer pathway follows this sequence:

  • Succinate oxidation by SDHA generates FADH₂

  • Electrons transfer from FADH₂ through the iron-sulfur clusters in SDHB

  • SDHC and SDHD facilitate electron transfer to ubiquinone at the QP site

  • The heme b group positioned between SDHC and SDHD mediates this electron transfer

Mechanistically, SDHC provides the structural framework for proper electron flow by positioning the ubiquinone binding site at the optimal orientation. Studies in model organisms have shown that mutations in SDHC can significantly reduce complex II activity while potentially not affecting the succinate dehydrogenase activity, indicating SDHC's specific role in electron transfer to coenzyme Q rather than in the initial succinate oxidation step .

What are the recognized protein domains and functional motifs in bovine SDHC?

Bovine SDHC contains several important domains and motifs that contribute to its function:

  • Succinate:quinone oxidoreductase (SQR) Type C domain: This domain is characteristic of the SDHC subunit family and is essential for membrane anchoring and electron transport

  • Transmembrane helices: Multiple transmembrane segments that anchor complex II to the inner mitochondrial membrane

  • Heme b coordination site: Residues that coordinate with the heme b prosthetic group shared between SDHC and SDHD

  • Ubiquinone binding region: Amino acids that contribute to the formation of the QP site where ubiquinone binds

The conserved domains in SDHC are critical for maintaining the proper assembly and stability of complex II. Mutations in these regions can disrupt electron transport efficiency and potentially lead to increased reactive oxygen species production .

What expression systems are most effective for producing recombinant bovine SDHC?

For successful expression of functional recombinant bovine SDHC, researchers should consider the following expression systems and methodological approaches:

  • Bacterial expression systems:

    • E. coli-based systems can be used but typically require optimization due to the hydrophobic nature of SDHC

    • Fusion tags (such as MBP or SUMO) can improve solubility

    • Specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression yield better results

  • Eukaryotic expression systems:

    • Yeast systems (S. cerevisiae or P. pastoris) provide a more native-like membrane environment

    • Mammalian cell lines (particularly bovine cell lines) offer proper post-translational modifications

    • Baculovirus-insect cell systems balance yield with proper folding

  • Cell-free expression systems:

    • Useful for rapid screening of conditions

    • Can be supplemented with lipids or detergents to support membrane protein folding

When expressing bovine SDHC, coexpression with other complex II subunits, particularly SDHD, significantly improves stability and proper folding. This approach better mimics the natural assembly process where SDHC-SDHD dimerization is a critical step in complex II formation .

What are the optimal methods for assessing bovine SDHC activity and electron transfer efficiency?

Assessment of bovine SDHC activity requires multiple complementary approaches:

  • Succinate-ubiquinone reductase (SQR) activity assay:

    • Measures complex II-specific electron transfer from succinate to ubiquinone

    • Protocol involves monitoring reduction of artificial electron acceptors (DCPIP, MTT)

    • Requires isolated mitochondria or reconstituted complex II

    • Activity is typically measured spectrophotometrically at 600nm (DCPIP) or 570nm (MTT)

  • Succinate dehydrogenase (SDH) activity assay:

    • Assesses specifically the SDHA/SDHB-catalyzed succinate oxidation

    • Can be performed using artificial electron acceptors like PMS/INT

    • Comparison with SQR activity helps distinguish SDHC-specific defects

  • Oxygen consumption measurements:

    • High-resolution respirometry using Oroboros or Seahorse platforms

    • Measures complex II-driven respiration using succinate as substrate

    • Complex II-specific inhibitors (malonate, thenoyltrifluoroacetone) serve as controls

  • Reactive oxygen species (ROS) production assay:

    • Since SDHC mutations can increase ROS, measuring superoxide or hydrogen peroxide production is valuable

    • Fluorescent probes like MitoSOX or AmplexRed can be used with appropriate controls

For bovine SDHC specifically, researchers should note that mutations may affect the QP site where electron leakage can occur, potentially increasing ROS production while not completely abolishing SDH activity .

How can researchers effectively detect and quantify recombinant bovine SDHC protein?

Several methodologies can be employed for detection and quantification of recombinant bovine SDHC:

  • Western blotting:

    • Sample preparation requires careful optimization due to SDHC's hydrophobic nature

    • Specialized membrane protein extraction buffers containing appropriate detergents (DDM, Triton X-100)

    • Heating samples at 37°C instead of boiling helps prevent aggregation

    • Anti-SDHC antibodies or antibodies against fusion tags can be used for detection

  • ELISA-based detection:

    • Sandwich ELISA formats using anti-SDHC antibodies can provide quantitative measurements

    • Commercial kits are available with sensitivity around 0.094ng/ml for human SDHC (but may need validation for bovine SDHC)

    • Protocol typically involves:

      • Sample incubation in antibody-coated wells

      • Addition of biotinylated detection antibody

      • Signal development using HRP-Streptavidin and TMB substrate

      • Measurement at 450nm

  • Mass spectrometry:

    • Targeted MS approaches (SRM/MRM) can provide absolute quantification

    • Requires development of SDHC-specific peptide standards

    • Sample preparation should include appropriate digestion protocols for membrane proteins

  • Blue Native PAGE:

    • Useful for assessing incorporation of SDHC into intact complex II

    • In-gel activity assays can determine functionality of the complex

The choice of method depends on the specific research question, with ELISA offering high sensitivity for purified protein, while Blue Native PAGE provides information about protein assembly into functional complexes.

How does bovine SDHC assemble with other subunits to form functional complex II?

The assembly of bovine SDHC into functional complex II follows a specific sequential process:

  • Initial assembly steps:

    • SDHA and SDHB form a catalytic dimer in the mitochondrial matrix

    • This hydrophilic SDHA-SDHB dimer formation precedes the membrane domain assembly

    • The SDHA-SDHB dimer can exist independently without the membrane anchors

  • Membrane domain formation:

    • SDHC and SDHD form a membrane-anchoring dimer

    • Heme b incorporation between SDHC and SDHD stabilizes this interaction

    • The hydrophilic domain (SDHA-SDHB) helps stabilize the SDHC-SDHD dimer

  • Complete assembly:

    • The SDHA-SDHB dimer associates with the SDHC-SDHD membrane dimer

    • Assembly factors and chaperones facilitate this process

    • Proper assembly is required for electron transfer from the catalytic domain to ubiquinone

Experimental evidence shows that in the absence of SDHC or with SDHC mutations, SDHA and SDHB can still be imported into mitochondria but fail to assemble into functional complex II . This underscores the critical role of SDHC in complex assembly and stability.

To study this assembly process, researchers can use techniques such as:

  • Pulse-chase experiments with radiolabeled subunits

  • Co-immunoprecipitation of complex II components

  • Blue Native PAGE to visualize assembly intermediates

  • Crosslinking mass spectrometry to map subunit interactions

What experimental approaches can identify SDHC interactions with coenzyme Q and other molecules?

Investigating SDHC interactions with coenzyme Q and other molecules requires specialized techniques:

  • Site-directed mutagenesis:

    • Systematic mutation of putative ubiquinone-binding residues in SDHC

    • Functional analysis of mutants to identify critical interaction points

    • Focus on regions known to form the QP site in complex II

  • Photoaffinity labeling:

    • Modified ubiquinone analogs with photoactivatable groups

    • UV-induced crosslinking followed by mass spectrometry analysis

    • Maps the precise binding sites on SDHC

  • Computational approaches:

    • Molecular docking simulations of coenzyme Q to SDHC-SDHD models

    • Molecular dynamics simulations to understand binding dynamics

    • Requires accurate structural models based on crystallographic data

  • Direct binding assays:

    • Microscale thermophoresis with purified components

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Electron paramagnetic resonance (EPR) spectroscopy:

    • Monitors the redox state of heme b and iron-sulfur clusters

    • Can detect perturbations in electron transfer upon ubiquinone binding

    • Requires specialized equipment and expertise

Research has shown that the QP site formed by SDHC and SDHD is a critical source of reactive oxygen species, making it particularly important to understand how coenzyme Q interactions might influence electron leakage and oxidative stress .

How do SDHC mutations affect complex II activity and what methodologies best detect these effects?

SDHC mutations can impact complex II in several distinct ways, each requiring specific detection methods:

  • Effects on complex assembly:

    • Mutations may prevent proper dimerization with SDHD

    • Blue Native PAGE and immunoprecipitation can assess assembly defects

    • Western blotting of mitochondrial fractions can reveal reduced complex II levels

  • Effects on electron transport:

    • Mutations, especially those near the QP site, may impair electron transfer to ubiquinone

    • Specialized activity assays that distinguish between SDH and SQR activities are crucial

    • The C. elegans mev-1 model demonstrates that SDHC mutations can reduce SQR activity by over 80% while not affecting SDH activity

  • Effects on ROS production:

    • SDHC mutations may increase electron leakage at the QP site

    • Fluorescent or chemiluminescent ROS detection assays are required

    • Comparison with appropriate controls (wild-type and positive controls)

  • Effects on protein stability:

    • Some mutations may destabilize SDHC structure

    • Thermal shift assays and limited proteolysis can assess stability changes

    • Pulse-chase experiments can measure protein half-life

Methodological approaches should include:

  • Comparisons of wild-type and mutant SDHC in reconstituted systems

  • Creation of cellular models expressing mutant SDHC

  • Use of specific inhibitors to dissect electron transport steps

  • Complementation studies in SDHC-deficient systems

Research indicates that mutations affecting the coenzyme Q-binding and heme b sites at the junction of SDHC and SDHD are particularly disruptive to electron transport function .

What research models are available for studying bovine SDHC function and mutations?

Several research models can be employed to study bovine SDHC:

  • Cell-based models:

    • Bovine cell lines with CRISPR/Cas9-mediated SDHC knockout

    • Reconstitution with wild-type or mutant bovine SDHC

    • Allows for controlled study of specific mutations

  • Yeast models:

    • S. cerevisiae lacking endogenous SDHC can be complemented with bovine SDHC

    • Enables high-throughput screening of mutations

    • Phenotypic assays include growth on non-fermentable carbon sources

  • C. elegans models:

    • The mev-1 mutant in C. elegans affects the SDHC homolog

    • Shows increased sensitivity to oxidative stress and reduced lifespan

    • Useful for studying oxidative stress responses

  • Bovine tissue samples:

    • Mitochondria isolated from various bovine tissues

    • Allows study of tissue-specific effects of SDHC

    • Can be used for biochemical and functional analyses

  • In vitro reconstitution:

    • Purified components assembled into proteoliposomes

    • Allows precise control of system composition

    • Useful for biophysical and structural studies

Each model system offers unique advantages. The C. elegans mev-1 model has been particularly informative, demonstrating that SDHC mutations can specifically affect electron transfer to coenzyme Q while leaving succinate oxidation intact . This distinction is critical for understanding the molecular mechanisms of SDHC dysfunction.

How can bovine SDHC research contribute to understanding neurodegenerative diseases?

Bovine SDHC research offers several pathways to advance our understanding of neurodegenerative diseases:

  • Oxidative stress mechanisms:

    • SDHC mutations can increase ROS production at the QP site

    • Neurons are particularly vulnerable to oxidative stress due to high energy demands

    • Research methodologies should include:

      • Measuring ROS production in neuronal models with altered SDHC

      • Assessing mitochondrial function in neurons with SDHC variants

      • Correlating SDHC-mediated ROS with neuronal survival

  • Mitochondrial dysfunction models:

    • Neurons rely heavily on mitochondrial energy production

    • SDHC alterations provide a targeted way to induce mitochondrial dysfunction

    • Research approaches include:

      • Primary neuronal cultures expressing bovine SDHC mutations

      • Assessment of mitochondrial transport in neuronal processes

      • Measurement of local ATP production in axons and dendrites

  • Comparative studies with human neurodegeneration:

    • Research has shown mitochondrial dysfunction is involved in Parkinson's disease pathogenesis

    • Dopaminergic neurons are particularly susceptible to mitochondrial defects

    • Studies in model organisms have demonstrated progressive loss of dopaminergic neurons with SDH subunit mutations

  • Therapeutic testing platforms:

    • SDHC-mutant models can serve as platforms for testing:

      • Antioxidant therapies

      • Mitochondrial protective compounds

      • Metabolic bypass strategies

By using bovine SDHC as a research tool, investigators can create precisely controlled models of mitochondrial dysfunction relevant to neurodegenerative conditions, particularly when combined with neuronal cell models or tissue cultures.

What methodologies are most effective for studying SDHC's role in reactive oxygen species generation?

Investigating SDHC's role in ROS generation requires specialized techniques:

  • Site-specific ROS detection methods:

    • MitoSOX Red for mitochondrial superoxide detection

    • Genetically encoded ROS sensors (roGFP, HyPer) for compartment-specific measurements

    • Spin trapping combined with electron paramagnetic resonance spectroscopy for specific radical identification

    • Proper controls include:

      • Positive controls (antimycin A for complex III-derived ROS)

      • Antioxidant treatments to confirm signal specificity

      • SDHC mutants with predicted effects on the QP site

  • Correlating structure with ROS production:

    • Introduction of specific SDHC mutations at the QP site

    • Measurement of ROS production rates with various substrates

    • Biochemical analysis of electron transfer efficiency

  • Physiological consequences assessment:

    • Measurement of oxidative damage markers (protein carbonylation, lipid peroxidation)

    • Assessment of mitochondrial membrane potential

    • Analysis of cellular antioxidant responses

  • High-resolution approaches:

    • Real-time monitoring of ROS production using fluorescent microscopy

    • Correlation with mitochondrial dynamics and morphology

    • Single-mitochondrion analysis when possible

Research has shown that the QP site, where SDHC contributes to ubiquinone binding, is an important source of reactive oxygen species . Mutations in SDHC can increase electron leakage at this site, potentially explaining the link between SDHC mutations and oxidative stress-related pathologies.

What emerging technologies show promise for advancing bovine SDHC research?

Several cutting-edge technologies are poised to transform bovine SDHC research:

  • Cryo-electron microscopy advances:

    • High-resolution structures of bovine complex II with various substrates

    • Visualization of conformational changes during electron transfer

    • Mapping of precise ubiquinone and inhibitor binding sites

  • Single-molecule techniques:

    • FRET-based approaches to monitor protein dynamics

    • Optical tweezers to study protein-protein interactions

    • Single-molecule electrophysiology for electron transfer events

  • Advanced genetic engineering:

    • CRISPR base editing for precise SDHC mutations

    • Tissue-specific and inducible SDHC variant expression

    • Humanized bovine models with patient-specific mutations

  • Multi-omics integration:

    • Combined proteomics, metabolomics, and transcriptomics

    • Systems biology approaches to understand SDHC in cellular context

    • Machine learning for prediction of mutation effects

  • Organoid and tissue-on-chip technologies:

    • Bovine tissue-derived organoids with SDHC variants

    • Microfluidic systems to study tissue-specific effects

    • Co-culture systems to investigate cell-cell interactions

These technologies will enable researchers to move beyond basic characterization of SDHC function to understanding its dynamic behavior in complex cellular systems and its role in disease processes. The integration of structural information with functional data will be particularly valuable for developing targeted therapeutic approaches for conditions involving SDHC dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.