Recombinant Bovine Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD)

Shipped with Ice Packs
In Stock

Description

Functional Role in Metabolic Pathways

SDHD, in conjunction with SDHC, forms the transmembrane dimer critical for:

  • Electron Transfer: Facilitates the reduction of ubiquinone via hydrogen bonding interactions (e.g., Tyr83 and Ser27 residues) .

  • Mitochondrial Anchoring: Ensures proper localization of the SDH complex within the inner mitochondrial membrane .

  • Succinate Oxidation: Links the citric acid cycle to the electron transport chain, preventing succinate accumulation—a hallmark of hypoxic tumors .

Key Functional Interactions

ComponentInteractionImpact
SDHCForms heterodimer with SDHDStabilizes ubiquinone-binding site
UbiquinoneBinds at O1 and O4 carbonyl groupsEnables electron relay to [3Fe-4S] cluster
SuccinateSubstrate for SDHA (FAD-dependent)Oxidized to fumarate, donating electrons

Source:

Disease-Associated Research

  • Cancer Biology: Underexpression of SDHD in clear cell renal cell carcinoma (ccRCC) correlates with hypermethylation and poor prognosis .

  • Genetic Disorders: Germline mutations in SDHD (e.g., R22X, R46X) cause paragangliomas by disrupting SDH activity and stabilizing hypoxia-inducible factors (HIFs) .

Disease ContextMechanismSDHD Impact
ccRCCmiR-210-mediated downregulationLoss of SDH activity → succinate buildup
ParagangliomaTruncating mutations (R22X/R46X)Defective electron transport → ROS accumulation

Source:

Comparative Analysis with Other SDH Subunits

While SDHD shares structural and functional similarities with SDHC, key differences exist:

SubunitRoleDisease Association
SDHCPartners with SDHD in transmembrane dimerParagangliomas (via truncating mutations)
SDHBIron-sulfur cluster bindingAggressive paragangliomas (missense variants)
SDHAFAD-dependent succinate oxidationLeigh syndrome (rare truncating mutations)

Source:

Challenges and Future Directions

  • Production Limitations: Cell-free systems may yield lower yields compared to E. coli-based systems, requiring optimization for large-scale use .

  • Therapeutic Potential: Restoring SDHD function in hypoxic tumors (e.g., via gene therapy) remains an active research area, though challenges include targeting mitochondrial localization .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
SDHD; SDH4; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; CybS; CII-4; QPs3; Succinate dehydrogenase complex subunit D; Succinate-ubiquinone reductase membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
56-158
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
SGSKAASLHWTGERVVSVLLLGLIPAAYLNPCSAMDYSLAATLTLHSHWGIGQVVTDYVH GDAVQKAAKTGLLVLSAFTFAGLCYFNYHDVGICKAVAMLWKL
Uniprot No.

Target Background

Function
This protein serves as the membrane-anchoring subunit of succinate dehydrogenase (SDH), a critical component of complex II in the mitochondrial electron transport chain. It plays a key role in transferring electrons from succinate to ubiquinone (coenzyme Q).
Database Links
Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of SDHD in the succinate dehydrogenase complex?

SDHD serves as a membrane-anchoring subunit of succinate dehydrogenase (SDH) that is crucial for complex II of the mitochondrial electron transport chain. Its primary function is to facilitate the transfer of electrons from succinate to ubiquinone (coenzyme Q) . The protein forms part of the interface between the catalytic head domain and anchor subunits of the SDH complex, which can be separated without detergent use, making the catalytic domain an "extrinsic" membrane protein .

Within the structure, electrons flow from FAD in SDHA through three Fe-S clusters in SDHB to the quinone-binding site at the membrane interface where SDHD is located . This positioning is critical for the enzyme's role in both oxidative phosphorylation and the tricarboxylic acid cycle.

What are the best experimental designs for studying SDHD function in bovine tissues?

For studying SDHD function in bovine tissues, a longitudinal experimental design with appropriate controls is recommended. Based on experimental design principles, researchers should consider:

  • Completely randomized design: Treatments should be assigned to experimental units entirely by chance to minimize bias .

  • Control groups: Establish baseline measurements using appropriate control samples to compare the effects of treatments .

  • Blocking variables: Account for sources of variability by grouping experimental units that are similar in ways expected to affect the response to treatments .

When specifically studying SDHD, consider these methodological approaches:

  • In vitro enzymatic assays: Measure SDH activity using spectrophotometric methods with isolated mitochondria from bovine tissues.

  • Gene expression analysis: Quantify SDHD expression levels in different bovine tissues under various physiological conditions.

  • Protein-protein interaction studies: Investigate interactions between SDHD and other components of the SDH complex.

For experimental validity, implement the three principles of experimental design :

  • Control lurking variables that might affect the response

  • Randomize to balance the effects of uncontrolled variables

  • Replicate to reduce the effects of chance variation

How can researchers effectively isolate and purify recombinant bovine SDHD for functional studies?

Isolation and purification of recombinant bovine SDHD typically involves expression in heterologous systems followed by appropriate purification methods. Based on the available information on recombinant SDHD production :

  • Expression system selection: E. coli is commonly used for recombinant SDHD expression, as indicated by available recombinant preparations .

  • Purification strategy:

    • Initial capture using affinity chromatography (if the recombinant protein includes an affinity tag)

    • Further purification via ion exchange chromatography

    • Final polishing using size exclusion chromatography

  • Storage conditions: Store purified SDHD in buffer containing glycerol at -20°C or -80°C for extended storage. Avoid repeated freeze-thaw cycles and prepare working aliquots for storage at 4°C for up to one week .

  • Quality control: Verify purity using SDS-PAGE and Western blotting with specific antibodies against SDHD. Assess functionality through activity assays measuring electron transfer capability.

What are the most sensitive methods for detecting bovine SDHD in different tissue samples?

Several methods are available for detecting bovine SDHD in tissue samples, each with different sensitivity profiles:

  • ELISA: Enzyme-linked immunosorbent assays using specific antibodies against bovine SDHD offer quantitative detection. Commercial kits have detection ranges of 3.125-100 ng/mL with sensitivities less than 0.1 ng/mL . The principle involves:

    • Double-antibody sandwich ELISA methodology

    • Pre-coated anti-bovine SDHD antibody as solid-phase antibody

    • HRP-labeled anti-bovine SDHD antibody as enzyme-labeled antibody

    • Formation of solid-phase antibody-antigen-enzyme-labeled antibody complex

    • Colorimetric detection after substrate addition

  • Western blotting: Using specific antibodies for bovine SDHD, this method provides semi-quantitative detection and information about protein size.

  • Immunohistochemistry: For localization of SDHD in fixed tissue samples.

  • Mass spectrometry: For highly sensitive, precise identification and quantification of SDHD.

MethodDetection RangeSensitivitySample TypesAdvantages
ELISA3.125-100 ng/mL<0.1 ng/mLSerum, plasma, tissue homogenatesHigh throughput, quantitative
Western BlotVariable~1-10 ngTissue extracts, cell lysatesSize verification, semi-quantitative
Mass Spectrometryfg-pg rangeVery highPurified samples, complex mixturesHigh specificity, can detect post-translational modifications

How can researchers validate the specificity of bovine SDHD antibodies for experimental use?

Validating antibody specificity is crucial for accurate SDHD detection. Researchers should employ multiple approaches:

  • Western blot analysis:

    • Test antibody against recombinant bovine SDHD to confirm binding to target protein

    • Compare with negative controls (non-related proteins) to verify absence of cross-reactivity

    • Perform peptide competition assays where pre-incubation with purified SDHD should abolish signal

  • Immunoprecipitation followed by mass spectrometry:

    • Use antibody to pull down proteins from bovine tissue extracts

    • Analyze precipitated proteins by mass spectrometry to confirm SDHD identity

    • Check for co-precipitation of known SDHD-interacting proteins

  • Testing across species:

    • Evaluate antibody reactivity against SDHD from different species to determine cross-reactivity

    • Commercial antibodies for SDHD are available with specific species reactivity profiles

  • Genetic knockdown controls:

    • Compare antibody signal in normal samples versus those with SDHD knockdown

    • Reduced signal in knockdown samples confirms specificity

  • Epitope mapping:

    • Determine the specific region of SDHD recognized by the antibody

    • Useful for understanding potential cross-reactivity issues

How can researchers accurately measure SDH enzyme activity when studying recombinant bovine SDHD?

Measuring SDH enzyme activity requires careful experimental design and appropriate assay selection:

  • Spectrophotometric assays:

    • Monitor the reduction of artificial electron acceptors like dichlorophenolindophenol (DCIP) or ferricyanide

    • DCIP turns from blue to colorless when reduced, allowing absorbance monitoring at 600 nm

    • Reaction mixtures typically contain succinate as substrate, phosphate buffer, and appropriate electron acceptors

  • Oxygen consumption measurements:

    • Using oxygen electrodes or optical sensors to measure oxygen consumption rates

    • Reflects the activity of the complete respiratory chain including SDH

  • Integration into reconstituted systems:

    • Incorporate purified recombinant SDHD into proteoliposomes with other SDH components

    • Measure electron transfer to ubiquinone analogs

  • Controls and validation:

    • Include specific SDH inhibitors (e.g., malonate, thenoyltrifluoroacetone) as negative controls

    • Normalize activity to protein concentration or mitochondrial content markers

    • Verify integrity of the complete SDH complex when studying individual subunits like SDHD

  • Temperature and pH considerations:

    • Maintain consistent temperature (typically 30-37°C) during assays

    • Optimize pH (usually 7.2-7.4) for maximum enzyme activity

What are the key experimental considerations when comparing wild-type and mutant forms of bovine SDHD?

When comparing wild-type and mutant forms of bovine SDHD, researchers should consider:

  • Mutation selection and design:

    • Target conserved residues based on sequence alignments across species

    • Consider known pathogenic mutations in human SDHD as guides

    • Use in silico protein structure analysis tools like DUET and mCSM-PPI scoring systems to predict structural consequences of missense mutations on protein stability and protein-protein interactions

  • Expression system standardization:

    • Ensure equivalent expression levels between wild-type and mutant proteins

    • Verify proper subcellular localization in cellular models

    • Assess protein stability and half-life differences

  • Functional assays:

    • Compare enzyme kinetics (Km, Vmax) between wild-type and mutant proteins

    • Measure electron transfer efficiency

    • Assess integration into the complete SDH complex

    • Evaluate impact on succinate metabolism and cellular bioenergetics

  • Structural analysis:

    • Use circular dichroism or thermal shift assays to detect structural alterations

    • Consider advanced techniques like cryo-EM to visualize structural differences

  • Cellular phenotypes:

    • Examine effects on mitochondrial membrane potential

    • Measure reactive oxygen species production

    • Assess impact on cellular growth and metabolism

How does SDHD dysfunction contribute to metabolic alterations in model systems?

SDHD dysfunction can lead to significant metabolic alterations that can be studied in various model systems:

  • Metabolite accumulation: SDHD dysfunction typically results in succinate accumulation, which can be measured as a biomarker. Studies have shown that carriers of pathogenic variants in succinate dehydrogenase genes (SDHx) exhibit altered metabolite ratios in blood plasma, with the succinate to fumarate ratio being particularly diagnostic (areas under the receiver operating characteristic curve 0.86-0.95) .

  • Cellular energy metabolism: Impaired SDH function affects both the TCA cycle and electron transport chain, potentially leading to:

    • Reduced ATP production

    • Increased glycolytic flux as compensation

    • Altered NAD+/NADH ratios

  • Model systems for study:

    • Animal models like SHR (spontaneously hypertensive rats) show changes in dopamine metabolism and uptake that may parallel some SDH-related metabolic alterations

    • Cell culture models with SDHD knockdown or mutation can reveal acute metabolic adaptations

    • Isolated mitochondria experiments can demonstrate direct bioenergetic consequences

  • Erythrocyte metabolic signatures: Recent research has shown that erythrocytes from individuals with SDHx mutations display strong metabolic alterations compared to controls, with 8 of 13 low-molecular organic acids showing significant differences (P < 0.05) . The lactate-α-ketoglutarate-ratio in erythrocytes can identify individuals with SDHx mutations.

  • Hypoxia signaling pathway interactions: SDH dysfunction may affect hypoxia-inducible factor (HIF) stabilization through succinate accumulation, influencing multiple metabolic pathways.

What are the cutting-edge approaches for investigating SDHD interactions with other mitochondrial proteins?

Several advanced techniques are being employed to study SDHD interactions with other mitochondrial proteins:

  • Proximity-based labeling techniques:

    • BioID or APEX2 fusion proteins can identify proteins in close proximity to SDHD in living cells

    • TurboID provides faster labeling kinetics for capturing transient interactions

  • Cryo-electron microscopy:

    • Enables visualization of SDHD within the intact SDH complex

    • Can reveal conformational changes upon substrate binding or interaction with other proteins

  • Crosslinking mass spectrometry:

    • Chemical crosslinking followed by mass spectrometry analysis identifies interaction interfaces

    • Zero-length crosslinkers provide information about direct protein-protein contacts

  • Genetic interaction screens:

    • CRISPR-based screens can identify synthetic lethal or rescue interactions

    • Helpful for mapping functional relationships between SDHD and other mitochondrial proteins

  • Fluorescence-based interaction assays:

    • Förster resonance energy transfer (FRET) to study protein interactions in living cells

    • Bimolecular fluorescence complementation (BiFC) for visualizing protein complex formation

  • Single-molecule techniques:

    • Single-molecule FRET to study conformational dynamics

    • Optical tweezers or atomic force microscopy to measure interaction forces

  • Computational approaches:

    • Molecular dynamics simulations to predict interaction interfaces

    • Network analysis of proteomic data to identify interaction hubs

What are common pitfalls in SDHD research and how can they be addressed?

Researchers working with SDHD should be aware of these common challenges and their solutions:

  • Protein instability issues:

    • Challenge: SDHD is a membrane protein and may be unstable when expressed recombinantly.

    • Solution: Use appropriate detergents for solubilization; consider fusion tags that enhance stability; express with partner proteins from the SDH complex.

  • Assay interference:

    • Challenge: Compounds in biological samples may interfere with SDH activity assays.

    • Solution: Include appropriate controls; use multiple complementary assay methods; perform spike recovery tests to assess matrix effects.

  • Expression system limitations:

    • Challenge: Prokaryotic expression systems may not provide proper folding for eukaryotic SDHD.

    • Solution: Consider eukaryotic expression systems; co-express with chaperones; optimize codons for the expression host.

  • Antibody cross-reactivity:

    • Challenge: Antibodies may cross-react with related proteins.

    • Solution: Validate antibody specificity using knockout/knockdown controls; perform peptide competition assays; use multiple antibodies targeting different epitopes.

  • Mitochondrial isolation artifacts:

    • Challenge: Isolation procedures may damage mitochondria and affect SDH activity measurements.

    • Solution: Use gentle isolation methods; measure markers of mitochondrial integrity; normalize results to mitochondrial content.

  • Storage stability concerns:

    • Challenge: SDHD preparations may lose activity during storage.

    • Solution: Store with glycerol at -20°C or -80°C; avoid repeated freeze-thaw cycles; prepare working aliquots .

How can researchers reconcile contradictory data on SDHD function from different experimental approaches?

When faced with contradictory data on SDHD function, researchers should:

  • Critically evaluate methodology:

    • Compare experimental conditions (pH, temperature, buffer composition)

    • Assess the quality and purity of reagents used

    • Consider the sensitivity and specificity of detection methods

  • Biological context considerations:

    • Different tissues may exhibit different SDHD functions or regulatory mechanisms

    • Developmental stage or physiological state may influence results

    • Species differences may explain some contradictions

  • Integrated data analysis approaches:

    • Perform meta-analysis of available data when possible

    • Use multiple complementary techniques to address the same question

    • Consider quantitative rather than qualitative comparisons

  • Molecular context:

    • SDHD functions as part of a complex; isolation may alter its properties

    • Post-translational modifications may differ between experimental systems

    • Presence of assembly factors may affect results (as seen with mitochondrial complex assembly)

  • Statistical considerations:

    • Evaluate statistical power of contradictory studies

    • Consider biological versus technical replication

    • Assess whether differences are statistically significant but biologically trivial

  • Design reconciliation experiments:

    • Create experiments specifically designed to address contradictions

    • Reproduce both contradictory conditions in parallel

    • Identify variables that might explain the differences

What emerging technologies show promise for advancing SDHD research?

Several emerging technologies hold potential for transforming SDHD research:

  • CRISPR-based approaches:

    • Base and prime editing for precise mutation introduction

    • CRISPRi/CRISPRa for temporal control of SDHD expression

    • CRISPR screens to identify novel SDHD regulators and interactors

  • Advanced imaging technologies:

    • Super-resolution microscopy for visualizing SDHD in mitochondrial membranes

    • Correlative light and electron microscopy (CLEM) for structural context

    • Live-cell imaging of SDHD dynamics using fluorescent tags

  • Single-cell technologies:

    • Single-cell proteomics to measure SDHD levels across heterogeneous populations

    • Single-cell metabolomics to assess metabolic impact of SDHD variation

    • Spatial transcriptomics to map SDHD expression in tissue context

  • Organoid and tissue models:

    • Patient-derived organoids to study SDHD in disease context

    • Tissue-on-chip systems for physiological SDHD studies

    • 3D bioprinted tissues with controlled SDHD expression

  • Computational approaches:

    • AI-driven protein structure prediction for SDHD variants

    • Systems biology modeling of SDH in metabolic networks

    • Quantum mechanical simulations of electron transfer

  • Metabolic flux analysis:

    • 13C-labeled metabolite tracing to quantify TCA cycle flux

    • Real-time metabolic measurements in living systems

    • Integration of multi-omics data for comprehensive metabolic mapping

How might understanding SDHD function contribute to broader research in mitochondrial biology and disease mechanisms?

Research on SDHD has implications that extend beyond this specific protein:

  • Insights into mitochondrial complex assembly:

    • SDHD assembly requires specific factors, providing a model for studying complex assembly mechanisms

    • Understanding these processes may reveal general principles applicable to other respiratory complexes

  • Disease mechanisms:

    • SDHx mutations are associated with tumors including paragangliomas, gastrointestinal stromal tumors, and renal cell carcinomas

    • Studies of SDHD may reveal how metabolic enzymes can function as tumor suppressors

    • Metabolic signatures associated with SDHD dysfunction (like succinate:fumarate ratios) could serve as biomarkers for early detection

  • Evolutionary biology:

    • SDHD is conserved across species, enabling comparative studies

    • Research on bacterial homologs may provide insights into mitochondrial evolution

  • Agricultural applications:

    • SDH is targeted by fungicides used against plant fungal pathogens

    • Understanding species-specific differences in SDHD could lead to more selective agricultural compounds

  • Therapeutic development:

    • Detailed understanding of SDHD structure and function could enable design of modulators for treating mitochondrial diseases

    • Knowledge of metabolic adaptations to SDHD dysfunction may suggest compensatory approaches

  • Fundamental bioenergetics:

    • SDHD research contributes to understanding electron transfer processes in biological systems

    • May provide insights applicable to artificial energy conversion systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.