Recombinant Bovine Surfeit locus protein 4 (SURF4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are standardly shipped with regular blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your preparation.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SURF4; Surfeit locus protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
SURF4
Target Protein Sequence
MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWN CGYLLASSFVFLNLLGQLTGCILVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFF SILQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW
Uniprot No.

Target Background

Function
Surfeit locus protein 4 (SURF4), an endoplasmic reticulum cargo receptor, plays a crucial role in lipoprotein export by recruiting cargos into COPII vesicles for secretion. It acts as a cargo receptor for lipoproteins containing both APOB and APOA1, thereby regulating lipoprotein delivery and maintaining lipid homeostasis. In conjunction with the GTPase SAR1B, SURF4 facilitates the transport of circulating lipoproteins. It further promotes the secretion of PCSK9 and efficiently mediates the secretion of erythropoietin (EPO). SURF4 may also contribute to maintaining the structure of the endoplasmic reticulum-Golgi intermediate compartment and the Golgi apparatus.
Database Links

KEGG: bta:526045

UniGene: Bt.63484

Protein Families
SURF4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is SURF4 and what is its primary function in cells?

SURF4 functions as an endoplasmic reticulum (ER) cargo receptor that facilitates the efficient secretion of various proteins. It is a transmembrane protein localized to the ER membrane that plays a crucial role in the ER-to-Golgi transport of specific cargo proteins . The protein mediates this function by recognizing specific motifs in cargo proteins and facilitating their incorporation into COPII vesicles for export from the ER.

Research has demonstrated that SURF4 is essential for maintaining proper protein trafficking from the ER to the Golgi apparatus. When SURF4 is disrupted, certain cargo proteins accumulate in the ER compartment, indicating its critical role in the early secretory pathway . This accumulation phenotype can be further enhanced by treating cells with brefeldin A, which disrupts ER-to-Golgi transport, suggesting that SURF4 functions specifically at this trafficking step .

How is recombinant bovine SURF4 typically produced for research purposes?

Recombinant bovine SURF4 production typically involves expression systems utilizing mammalian, insect, or bacterial hosts depending on the specific research requirements. For functional studies requiring proper folding and post-translational modifications, mammalian expression systems (such as HEK293 or CHO cells) are preferable.

The methodology involves:

  • Cloning the bovine SURF4 coding sequence (based on UniProt accession A7YY49) into an appropriate expression vector

  • Incorporating purification tags (such as His-tag or FLAG-tag) to facilitate downstream purification

  • Transfecting host cells and selecting stable clones expressing the recombinant protein

  • Optimizing culture conditions to enhance protein expression

  • Employing membrane protein extraction techniques using detergents

  • Purifying the protein via affinity chromatography based on the incorporated tags

When analyzing recombinant SURF4 function, researchers must consider maintaining the protein's transmembrane topology and ensuring proper folding of both lumenal and cytoplasmic domains that are critical for cargo and COPII interaction, respectively.

What are the known cargo proteins that interact with SURF4?

Several cargo proteins have been identified as SURF4 clients through various biochemical and genetic approaches. The most well-characterized cargo proteins include:

  • Erythropoietin (EPO): SURF4 physically interacts with EPO and facilitates its secretion. Disruption of SURF4 results in intracellular accumulation of EPO in the ER compartment and decreased extracellular levels .

  • Proprotein convertase subtilisin/kexin type 9 (PCSK9): SURF4 mediates PCSK9 secretion through a mechanism that requires the co-receptor TMED10 .

  • Calcium-binding protein 45 (Cab45): SURF4 interacts with Cab45 co-translationally following signal peptide cleavage, which exposes the ER-ESCAPE motif necessary for SURF4 binding .

  • Nucleobindin-1 (NUCB1): Similar to Cab45, NUCB1 also binds to SURF4 co-translationally and requires signal peptide cleavage for this interaction to occur .

Research indicates that different cargo proteins utilize distinct mechanisms for SURF4-mediated export, with some requiring additional co-receptors and others engaging directly with SURF4 following translation .

What experimental methods are used to study SURF4-cargo interactions?

Several sophisticated methodologies have been developed to study SURF4-cargo interactions:

  • Site-specific crosslinking: Using amber suppression technology to incorporate photo-crosslinkable amino acids (such as Bpa) at specific positions within cargo proteins to capture transient interactions with SURF4. This approach has been successfully used to demonstrate co-translational interaction between SURF4 and cargo proteins like Cab45 .

  • Co-immunoprecipitation (Co-IP): This classic approach involves pulling down SURF4 (typically tagged with epitopes like FLAG) and identifying associated cargo proteins through western blotting or mass spectrometry analysis .

  • NanoBiT complementation assay: An in-cell protein-protein interaction assay based on reconstitution of luciferase activity when two proteins come into proximity. This has been used to demonstrate interactions between SURF4 and SEC24 adaptor proteins .

  • Pulse-chase experiments: These track the intracellular retention and secretion kinetics of cargo proteins in the presence or absence of SURF4 .

  • Truncation analysis and ribosome-nascent chain complexes: These approaches have been used to identify the minimal length of nascent cargo required for SURF4 interaction, providing insights into co-translational binding mechanisms .

Each of these methods offers distinct advantages for investigating different aspects of SURF4-cargo interactions, from initial binding to trafficking dynamics.

How does SURF4 recognize different cargo proteins and what motifs are involved?

SURF4 exhibits remarkable selectivity in cargo recognition through specific structural motifs and binding domains. The primary recognition system involves:

  • ER-ESCAPE motifs: These are typically positively charged, hydrophobic motifs present in cargo proteins that become exposed after signal peptide cleavage. The motifs interact with a highly conserved lumenal pocket in SURF4 that contains both negatively charged and hydrophobic residues .

  • SURF4 binding pocket: Mutagenesis studies have identified a critical lumenal domain of SURF4 that recognizes ER-ESCAPE motifs. This domain forms a pocket lined with negatively charged and hydrophobic residues that complement the properties of the ER-ESCAPE motifs .

  • Co-translational recognition: For cargo proteins like Cab45 and NUCB1, SURF4 recognition occurs co-translationally, with interaction beginning once approximately 125 amino acids of the cargo have been synthesized. This corresponds to about 39 amino acids being available in the ER lumen after signal peptide cleavage, suggesting that steric accessibility is the primary factor limiting early interaction .

  • Co-receptor requirements: For some cargo proteins, like PCSK9, efficient SURF4-mediated export requires additional co-receptors such as TMED10. This creates a more complex recognition system involving multiple components .

When designing experiments to study these recognition mechanisms, researchers should consider site-directed mutagenesis of both the cargo's ER-ESCAPE motifs and the SURF4 binding pocket, along with crosslinking approaches to capture the transient interactions that occur during translation.

What are the detailed mechanisms of SURF4-mediated ER export and how does it interact with the COPII machinery?

SURF4 mediates ER export through a sophisticated interaction network with the COPII machinery:

  • SEC24 adaptor paralog specificity: Different cargo proteins exported by SURF4 utilize different SEC24 paralogs. For example, PCSK9 export depends on SEC24A, while Cab45 and NUCB1 utilize SEC24C/D .

  • B-site interaction: SURF4 engages with the conserved B-site on SEC24 proteins. This interaction is critical for incorporating SURF4 and its cargo into COPII vesicles .

  • Cytoplasmic domains: Mutagenesis studies have identified specific cytoplasmic regions of SURF4 that are essential for SEC24 interaction, including a loop between transmembrane helices 4 and 5 (termed the Phe-loop) and residues in the C-terminal tail .

  • Co-receptor mechanisms: For cargo like PCSK9, the co-receptor TMED10 facilitates the formation of a ternary complex (PCSK9/SURF4/TMED10) that is recognized by SEC24A through both B-site and D-site interactions. Knockdown of TMED10 significantly reduces the SURF4-SEC24A interaction, highlighting its importance in this export pathway .

  • Multiple binding sites: Different domains of SURF4 interact with cargo (lumenal domain) and SEC24 (cytoplasmic domain), creating a bridge between lumenal cargo and the cytoplasmic COPII machinery .

The experimental approach to studying these mechanisms often combines biochemical interaction assays (like NanoBiT), mutagenesis of interaction sites, and functional trafficking assays to correlate binding with export efficiency.

How does SURF4 overexpression affect recombinant protein secretion efficiency?

SURF4 overexpression has been shown to significantly enhance the secretion efficiency of various cargo proteins, making it a potentially valuable tool for recombinant protein production:

  • Enhanced EPO secretion: Research has demonstrated that SURF4 overexpression results in increased secretion of EPO, suggesting a potential strategy for more efficient production of recombinant EPO .

  • Increased secretion from endogenous loci: SURF4 overexpression enhances secretion of EPO expressed from its endogenous genomic locus in Hep3B cells, without significant changes in cellular EPO mRNA levels. This indicates that the effect is at the level of protein trafficking rather than gene expression .

  • Cargo-specific effects: While SURF4 overexpression enhances secretion of its cargo proteins, the magnitude of this effect may vary depending on the specific cargo and cell type. Researchers should characterize these effects for their protein of interest.

To implement SURF4 overexpression as a strategy for enhancing recombinant protein production, researchers should consider:

  • Developing stable cell lines with controlled SURF4 expression levels

  • Optimizing the ratio of SURF4 to cargo protein expression

  • Assessing potential ER stress responses that might result from altered trafficking dynamics

  • Monitoring product quality to ensure that accelerated secretion does not compromise proper folding or post-translational modifications

This approach offers a novel strategy for improving the efficiency of recombinant protein production systems, particularly for SURF4 client proteins.

What is the role of co-translational interactions in SURF4-mediated protein secretion?

The co-translational nature of SURF4 interactions with certain cargo proteins represents a sophisticated quality control mechanism in the secretory pathway:

  • Signal peptide cleavage dependency: For cargo proteins like Cab45 and NUCB1, interaction with SURF4 occurs co-translationally and depends on signal peptide cleavage, which exposes the ER-ESCAPE motif .

  • Nascent chain length requirements: Experimental evidence using ribosome-trapped nascent chains shows that SURF4 can interact with Cab45 once approximately 125 amino acids have been translated. This corresponds to about 39 amino acids being available in the ER lumen (after accounting for residues in the ribosome exit tunnel and translocon), suggesting that steric accessibility is the main limiting factor .

  • Calcium homeostasis regulation: This co-translational mode of interaction may ensure the rapid export of Ca²⁺-binding proteins, preventing calcium sequestration in the ER and maintaining proper calcium homeostasis .

  • Glycosylation interactions: N-glycosylation near the SURF4 binding site can modulate the interaction, with evidence suggesting competitive effects between glycosylation machinery and SURF4 binding .

The co-translational binding of SURF4 represents an important mechanism for efficient sorting of proteins early in their biosynthesis, ensuring that cargo proteins destined for secretion are rapidly channeled into the appropriate export pathway before they can accumulate in the ER.

What methodological approaches can be used to identify new SURF4 cargo proteins?

Identifying novel SURF4 cargo proteins requires sophisticated experimental approaches:

  • Genome-scale CRISPR/Cas9 knockout screens: These screens can be designed with reporters that provide quantifiable readouts of intracellular protein accumulation. This approach was successfully used to identify SURF4 as a mediator of EPO secretion .

  • Proteomics of secreted proteins: Comparative proteomic analysis of the secretome from wild-type versus SURF4-deficient cells can identify proteins whose secretion depends on SURF4.

  • Site-specific crosslinking coupled with mass spectrometry: Incorporating photo-crosslinkable amino acids into SURF4 at predicted cargo-binding sites, followed by crosslinking and mass spectrometry analysis, can identify proteins that directly interact with SURF4.

  • Co-essentiality mapping: Bioinformatic approaches that identify proteins with predicted shared phenotypes in CRISPR screens (co-essentiality) can identify potential functional partners of SURF4, including cargo proteins and co-receptors .

  • ER-ESCAPE motif analysis: Computational approaches to identify proteins containing potential ER-ESCAPE motifs can generate candidates for experimental validation.

A comprehensive approach would combine these methods, followed by validation experiments including:

  • Demonstrating direct physical interaction with SURF4

  • Showing intracellular accumulation in SURF4-deficient cells

  • Confirming reduced secretion in the absence of SURF4

  • Rescuing secretion defects with SURF4 re-expression

This multi-layered approach can identify both direct SURF4 cargo proteins and accessory factors involved in SURF4-mediated secretion.

How should researchers design experiments to study SURF4 function in bovine systems?

When designing experiments to study bovine SURF4 function, researchers should consider several key factors:

  • Cell model selection: Choose appropriate bovine cell lines that express proteins of interest or can be engineered to express recombinant proteins. Bovine mammary epithelial cells or bovine kidney cells are commonly used models.

  • CRISPR/Cas9 genome editing: Design multiple independent sgRNAs targeting bovine SURF4, followed by validation of knockout efficiency through sequencing and western blotting. Complete knockout clones should be generated alongside control cells .

  • Rescue experiments: Include rescue conditions where wild-type bovine SURF4 cDNA is re-expressed in knockout cells to confirm phenotype specificity and rule out off-target effects .

  • Cargo protein selection: Select relevant cargo proteins that are expected to interact with SURF4 in bovine cells, particularly those with known or predicted ER-ESCAPE motifs.

  • Experimental readouts:

    • Intracellular accumulation of cargo proteins (by western blotting or fluorescent reporters)

    • Secretion efficiency (measuring protein levels in conditioned media)

    • Ratio of extracellular to intracellular cargo levels

    • Subcellular localization of cargo proteins (by immunofluorescence microscopy)

  • Physiological induction: For proteins like EPO, include conditions that mimic physiological induction (such as hypoxia) to assess SURF4 function under relevant stimuli .

These experimental designs should include appropriate controls, multiple biological replicates, and statistical analysis to ensure robust and reproducible results.

What are common challenges in expressing and purifying recombinant bovine SURF4?

Researchers face several challenges when expressing and purifying recombinant bovine SURF4:

  • Membrane protein solubilization: As a multi-pass transmembrane protein, SURF4 requires careful optimization of detergent conditions for extraction from membranes without denaturing the protein's structure.

  • Maintaining native conformation: Preserving the native conformation of both lumenal and cytoplasmic domains is essential for functional studies, particularly for cargo-binding assays.

  • Expression system selection: While bacterial expression systems may provide high yields, they often fail to properly fold complex mammalian membrane proteins. Mammalian or insect cell expression systems typically provide better quality but lower yields.

  • Protein stability: SURF4 may exhibit limited stability once extracted from membranes, requiring careful optimization of buffer conditions and storage protocols.

  • Functional validation: Confirming that purified recombinant SURF4 retains cargo-binding activity is essential and may require development of in vitro binding assays.

Solutions to these challenges include:

  • Using mild detergents or detergent-lipid mixtures for solubilization

  • Incorporating stabilizing agents in purification buffers

  • Considering nanodiscs or liposome reconstitution for functional studies

  • Employing GFP fusion tags to monitor folding and expression efficiency

  • Developing robust quality control assays to confirm protein integrity and activity

Each batch of purified SURF4 should be characterized for purity, stability, and functional activity before use in downstream applications.

How can researchers quantitatively assess SURF4-mediated protein secretion?

Quantitative assessment of SURF4-mediated protein secretion requires robust methodological approaches:

  • Secretion efficiency assays:

    • Measure the ratio of extracellular to intracellular cargo protein levels using western blotting or ELISA

    • Normalize secreted protein amounts to cell number or total cellular protein

    • Compare wild-type, SURF4-knockout, and rescue conditions to determine SURF4-dependent secretion

  • Pulse-chase experiments:

    • Label newly synthesized proteins with radioactive amino acids or click chemistry-compatible amino acids

    • Chase for various time points to track the kinetics of cargo secretion

    • Compare secretion rates between control and SURF4-deficient cells

  • Reporter systems:

    • Develop fluorescent or luminescent reporters fused to cargo proteins

    • Measure intracellular retention (by microscopy or flow cytometry) and secretion (by measuring reporter activity in culture media)

    • Design ratiometric measurements to compare intracellular and extracellular signal

  • Quantitative microscopy:

    • Use fluorescently-tagged cargo proteins to visualize trafficking through the secretory pathway

    • Perform live-cell imaging to track cargo movement in real-time

    • Quantify ER retention versus Golgi localization in the presence or absence of SURF4

  • Mass spectrometry-based secretomics:

    • Perform SILAC or TMT labeling to compare secretomes of control versus SURF4-deficient cells

    • Identify and quantify differentially secreted proteins

    • Validate findings using targeted approaches for specific cargo proteins

What is the most effective method to analyze SEC24 paralog specificity in SURF4-mediated export?

Analyzing SEC24 paralog specificity in SURF4-mediated export requires sophisticated experimental approaches:

  • Paralog-specific knockdown/knockout:

    • Design siRNAs or CRISPR guides targeting individual SEC24 paralogs (SEC24A, B, C, and D)

    • Confirm knockdown/knockout efficiency by western blotting

    • Assess cargo secretion defects specific to each paralog depletion

  • Protein-protein interaction assays:

    • Use NanoBiT complementation assays to quantify SURF4 interaction with different SEC24 paralogs

    • Perform co-immunoprecipitation experiments with tagged SEC24 paralogs to identify associated cargo

    • Apply site-specific crosslinking to capture transient interactions between SURF4 and SEC24 proteins

  • Domain mapping and mutagenesis:

    • Create mutations in the cargo-binding sites of different SEC24 paralogs (B-site, IxM-site, etc.)

    • Test the effect of these mutations on SURF4 interaction and cargo secretion

    • Identify paralog-specific binding requirements

  • Cargo-specific analysis:

    • Compare the SEC24 paralog requirements for different SURF4 cargoes (e.g., EPO, PCSK9, Cab45)

    • Identify cargo features that determine SEC24 paralog specificity

    • Test chimeric cargo proteins to map determinants of paralog specificity

  • Inhibitor studies:

    • Use specific inhibitors like 4-PBA that target the B-site interaction to disrupt SURF4-SEC24 binding

    • Compare inhibitor sensitivity across SEC24 paralogs

This experimental approach can elucidate the mechanisms underlying the surprising specificity of SURF4-cargo complexes for different SEC24 paralogs, which is a key aspect of SURF4's function in the early secretory pathway.

How can SURF4 manipulation be applied to enhance recombinant protein production?

SURF4 manipulation offers promising strategies for enhancing recombinant protein production systems:

  • SURF4 overexpression platforms:

    • Developing stable cell lines with controlled SURF4 overexpression

    • Creating inducible SURF4 expression systems that can be activated during production phases

    • Optimizing SURF4 expression levels to maximize secretion without inducing ER stress

  • Cargo-specific optimization:

    • Engineering cargo proteins to enhance their interaction with SURF4 (e.g., optimizing ER-ESCAPE motifs)

    • Co-expressing relevant co-receptors (like TMED10) that facilitate SURF4-mediated export of specific cargoes

    • Developing cargo-SURF4 fusion proteins for difficult-to-secrete products

  • Production process integration:

    • Monitoring SURF4 expression levels throughout production processes

    • Implementing feed strategies that maintain optimal SURF4:cargo ratios

    • Developing screening platforms to identify cell clones with enhanced SURF4-mediated secretion

  • Combined approaches:

    • Integrating SURF4 overexpression with other secretion-enhancing strategies

    • Coupling SURF4 manipulation with ER stress mitigation approaches

    • Combining SURF4 enhancement with Golgi transport optimization

This approach is particularly promising for enhancing production of SURF4 client proteins like EPO, where SURF4 overexpression has been shown to increase secretion efficiency without affecting transcript levels . The strategy offers a complementary approach to traditional methods that focus on enhancing transcription or translation.

What potential therapeutic applications exist for modulating SURF4 activity?

Modulating SURF4 activity holds promise for various therapeutic applications:

  • Disorders of erythropoiesis:

    • Enhancing SURF4 activity could potentially increase EPO secretion and benefit patients with certain types of anemia

    • Conversely, in polycythemia vera, inhibiting SURF4 might help reduce excessive EPO production

  • Lipid metabolism disorders:

    • SURF4 mediates PCSK9 secretion, a key regulator of LDL receptor levels

    • Inhibiting SURF4 could potentially reduce PCSK9 secretion, increasing LDL receptor expression and lowering cholesterol levels, similar to PCSK9 inhibitors currently used in hypercholesterolemia

  • Protein misfolding diseases:

    • Enhancing SURF4 activity might facilitate the export of certain mutant proteins that retain some functionality but exhibit trafficking defects

    • This could potentially benefit conditions like certain forms of cystic fibrosis or alpha-1 antitrypsin deficiency

  • Cancer therapeutics:

    • Some cancer cells may depend on efficient protein secretion for survival

    • Targeting SURF4 could potentially disrupt secretion of growth factors or other proteins essential for tumor progression

  • Inflammatory conditions:

    • SURF4 may regulate secretion of certain cytokines or inflammatory mediators

    • Modulating its activity could potentially affect inflammatory responses

Developing therapeutic approaches would require:

  • High-throughput screening for small molecule modulators of SURF4

  • Cargo-specific SURF4 modulators to avoid broad secretory pathway disruption

  • Tissue-specific delivery systems to target SURF4 modulation to relevant cell types

  • Detailed safety assessment to understand the consequences of altering SURF4 activity in various tissues

What are the current gaps in our understanding of SURF4 biology and function?

Despite significant advances, several important knowledge gaps remain in SURF4 biology:

  • Comprehensive cargo identification:

    • The full repertoire of SURF4 cargo proteins remains unknown

    • Systematic approaches are needed to identify all proteins that depend on SURF4 for efficient secretion

    • Species-specific differences in SURF4 cargo selectivity require further investigation

  • Regulatory mechanisms:

    • How SURF4 activity is regulated under different physiological conditions is poorly understood

    • Potential post-translational modifications of SURF4 that might modulate its function remain to be characterized

    • Whether SURF4 expression or activity changes in response to secretory demand requires investigation

  • Structural insights:

    • High-resolution structures of SURF4, particularly in complex with cargo proteins, are lacking

    • The precise molecular determinants of cargo selectivity remain to be fully elucidated

    • Conformational changes during cargo binding and release need characterization

  • Tissue-specific functions:

    • Whether SURF4 has tissue-specific roles or cargo preferences is unclear

    • Potential redundancy with other cargo receptors in different tissues requires investigation

    • The consequences of SURF4 deficiency in different tissues and developmental stages need further study

  • Pathological implications:

    • The involvement of SURF4 in various disease states remains largely unexplored

    • Whether SURF4 mutations or expression changes contribute to human diseases is unknown

    • The potential of SURF4 as a therapeutic target requires further validation

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, proteomics, genetics, and cell biology to fully understand SURF4's complex role in the secretory pathway.

How might the function of SURF4 differ between bovine and other mammalian systems?

Comparing SURF4 function across species provides valuable insights into conserved and divergent aspects of ER export machinery:

  • Sequence conservation and divergence:

    • Bovine SURF4 (UniProt A7YY49) shares high sequence identity with human SURF4, suggesting conserved core functions

    • Species-specific differences may exist in regulatory domains or cargo-binding regions

    • Comparative sequence analysis can identify highly conserved residues likely critical for function versus more variable regions that may confer species-specific properties

  • Cargo specificity differences:

    • Certain cargo proteins may show species-specific dependence on SURF4

    • Post-translational modifications of cargo proteins may differ between species, potentially affecting SURF4 recognition

    • Species-specific co-receptors might influence SURF4-mediated export of certain cargoes

  • Expression patterns and regulation:

    • SURF4 expression levels and tissue distribution might vary between bovine and other mammalian systems

    • Regulatory mechanisms controlling SURF4 expression could differ, particularly in specialized secretory tissues

    • Stress responses affecting the secretory pathway might differentially impact SURF4 function across species

  • Experimental considerations:

    • When studying bovine SURF4 function, species-matched experimental systems should be used when possible

    • Complementation experiments between bovine and human SURF4 can identify functionally conserved domains

    • Species-specific antibodies or detection reagents may be required for accurate analysis

Understanding these species-specific aspects of SURF4 function is particularly important for:

  • Translating findings between model systems

  • Developing veterinary applications based on SURF4 biology

  • Optimizing recombinant protein production in bovine cell systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.