Recombinant Bovine Synaptogyrin-2 (SYNGR2)

Shipped with Ice Packs
In Stock

Description

Applications in Research

Recombinant SYNGR2 is utilized for:

  • Protein Interaction Studies: Investigating SYNGR2’s role in viral replication mechanisms, particularly its interaction with viral non-structural proteins (e.g., SFTSV NSs) to form inclusion bodies that facilitate viral RNA synthesis .

  • Antibody Production: Serving as an immunogen for generating antibodies used in Western blot (WB), ELISA, and protein purification arrays .

  • Vesicle Trafficking Assays: Studying membrane dynamics due to SYNGR2’s involvement in lipid droplet restructuring and vesicle formation .

Viral Replication Enhancement

  • SYNGR2 interacts with SFTSV NSs to restructure lipid droplets into viral replication factories, increasing viral RNA yield by 10–275-fold in infected cells .

  • In porcine models, CRISPR-edited SYNGR2 p.63Cys variants reduce PCV2 replication by 50–70%, confirming its pro-viral function .

Research Limitations and Gaps

  • Species-Specific Data: Most functional studies focus on human or porcine SYNGR2, necessitating further validation for bovine applications.

  • Mechanistic Details: The exact role of bovine SYNGR2 in vesicle trafficking remains inferred from ortholog studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
SYNGR2; Synaptogyrin-2; Cellugyrin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
SYNGR2
Target Protein Sequence
MESGAYGAPRAGGSFDLRRFLKQPQVVVRAVCLVFALIVFSCIFGEGYSNTHDSQQQYCV FNRNEDACRYGSAIGVLAFLASAFFFVVDIYFPQISNATDRKYLVIGDLLFSALWTFLWF VGFCFLTNQWAATKKNDVHVEADSARAAITFSFFSIFSWCVLAFLAYQRYKAGVDEFIQN YVDPTPDPSTAYASYPGVPADTYQQPPFTQNAESTEGYQPPPVY
Uniprot No.

Target Background

Function

Synaptogyrin-2 (SYNGR2) may play a role in regulated exocytosis. In neuronal cells, it modulates the localization of synaptophysin (SYP) within synaptic-like microvesicles, potentially influencing vesicle formation and/or maturation. Additionally, SYNGR2 may be involved in GLUT4 storage and transport to the plasma membrane.

Database Links

KEGG: bta:513812

STRING: 9913.ENSBTAP00000025388

UniGene: Bt.3410

Protein Families
Synaptogyrin family
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein.

Q&A

What is the mechanistic role of SYNGR2 in viral replication cycles?

SYNGR2 facilitates viral replication by reorganizing host cell structures into viral factories. Studies on severe fever with thrombocytopenia syndrome virus (SFTSV) demonstrate that SYNGR2 interacts with the viral nonstructural protein NSs to transform lipid droplets into inclusion bodies (IBs) essential for RNA replication . Methodologically, this was proven through:

  • Co-immunoprecipitation assays confirming SYNGR2-NSs interactions

  • Confocal microscopy showing SYNGR2 translocation into lipid droplets during infection

  • shRNA knockdown experiments reducing IB formation and viral titers by 60–80%

Table 1: Impact of SYNGR2 Modulation on SFTSV Replication

Experimental ConditionViral Titer (Log<sub>10</sub> TCID<sub>50</sub>/mL)M Gene Expression (Fold Change)
SYNGR2 knockdown3.2 ± 0.48.5 ± 1.2
SYNGR2 overexpression6.8 ± 0.642.3 ± 3.8
Control5.1 ± 0.325.6 ± 2.1
Data derived from HeLa cell models

How does SYNGR2 expression correlate with cancer progression?

In esophageal squamous cell carcinoma (ESCC), SYNGR2 overexpression associates with poor prognosis and immune evasion. Key methodologies include:

How should researchers address contradictory findings about SYNGR2’s pro- versus antiviral roles?

Contradictions arise from species-specific interactions and experimental systems. For example:

  • Pro-viral activity: SYNGR2 enhances SFTSV replication in human cells by promoting IB formation

  • Antiviral adaptation: Domestic pigs with the SYNGR2 p.63Cys allele exhibit 40% lower porcine circovirus type 2b (PCV2b) loads compared to wild-type alleles

Resolution strategies:

  • Contextualize model systems: Compare human (HepG2/HeLa) versus porcine (PK15) cell lines

  • Analyze evolutionary signatures: Detect positive selection in SYNGR2’s intraluminal loop domains across mammals

  • Validate interactions using orthogonal methods (e.g., in situ hybridization + proteomics)

What experimental designs optimize SYNGR2 interaction studies?

Robust workflows integrate genetic and imaging approaches:

  • CRISPR/Cas9 editing to generate isogenic cell lines (e.g., PK15 SYNGR2 p.63Cys clones)

  • Structured illumination microscopy to resolve SYNGR2-NSs complexes in IBs (<100 nm resolution)

  • Crosslinking immunoprecipitation (CLIP) for mapping RNA-protein interactions during viral assembly

How does SYNGR2 influence host-pathogen evolutionary dynamics?

Long-term virus-host coevolution has shaped SYNGR2 diversity:

  • Population genetics: The SYNGR2 p.63Cys allele occurs in 97.7% of European domestic pigs but 0% of Asian wild boars

  • Functional divergence: Synergistic evolution in loop domains impacts viral entry mechanisms across mammals

Table 2: Evolutionary Conservation of SYNGR2 Functional Domains

DomaindN/dS RatioPositively Selected Sites
N-terminal luminal loop0.8258, 63, 71
Transmembrane helix 30.45None
C-terminal tail1.12129, 135
dN/dS >1 indicates positive selection

What controls are essential for SYNGR2 knockdown/overexpression studies?

  • Scramble shRNA controls to exclude off-target effects

  • Rescue experiments with codon-optimized SYNGR2 constructs

  • Time-course analyses to separate primary vs. secondary effects (e.g., measure viral RNA at 12/24/36 hpi)

How can researchers validate SYNGR2’s immune-modulatory roles?

  • Multiplex cytokine profiling (e.g., Luminex assays) to quantify CCL2/CXCL12 levels in SYNGR2<sup>high</sup> tumors

  • Single-cell RNA-seq of tumor-infiltrating lymphocytes to resolve T cell exhaustion signatures

  • Methylation-specific PCR correlating SYNGR2 promoter methylation with PD-L1 expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.