Recombinant Bovine Synaptophysin (SYP)

Shipped with Ice Packs
In Stock

Description

Functional Mechanisms in Synaptic Vesicle Recycling

Recombinant Bovine SYP plays two critical roles:

SybII Trafficking Control

  • Binds SybII’s SNARE motif through AA 238-244 in its C-terminus

  • Enables activity-dependent retrieval of SybII from presynaptic membranes (67% efficiency improvement in rescue experiments)

Vesicle Endocytosis Regulation

  • Modulates synaptic vesicle recycling kinetics (τ = 45s baseline vs. 85s under β-amyloid-42 exposure)

  • Maintains SybII clustering via transmembrane domain interactions, preventing premature SNARE complex assembly

Key Research Findings

Table 2: Experimental Insights from Recombinant SYP Studies

Study FocusMethodologyOutcomeSource
SybII Retrieval DefectsSyp knockout neurons + C-terminal mutantsT60 mutant (AA 1-244) restored 92% of SybII retrieval capacity
β-Amyloid-42 InteractionCo-immunoprecipitation assaysReduced SYP/VAMP2 complexes by 50% at 500 nM Aβ42 concentration
circRNA ModulationHT22 cell overexpression2.3-fold Syp protein increase upon circ-Vps41 transfection

Experimental Applications

Recombinant Bovine SYP is utilized in:

  • Synaptic plasticity models: Overexpression reverses D-galactose-induced Syp depletion (75 mM D-gal reduced Syp by 60%; rescued to 85% baseline with circ-Vps41 co-expression)

  • Neurodegeneration studies: Identified as primary β-amyloid target disrupting vesicle release kinetics (τ >400s in 23% of Aβ42-treated synapses)

  • Protein interaction mapping: Forms 12:6 SybII:SYP stoichiometric complexes in rosette structures

Technical Considerations

  • Antibody Validation: Requires epitope-specific testing due to cross-reactivity risks with paralogs like synaptogyrin-1

  • Conformational Sensitivity: C-terminal truncations (e.g., T22 mutant) alter endocytosis kinetics by 40%

  • Storage: Lyophilized protein retains activity for 24 months at -80°C but degrades 30% faster in solution phase

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SYP; Synaptophysin; Major synaptic vesicle protein p38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
SYP
Target Protein Sequence
MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANK TKSDLNIEVEFEYPFRLHEVYFEAPTCQGDPKKIFLVGNYSSSAEFFVTVAVFAFLYSMG ALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKGM HVCHQPGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAP EKQPAPGDAYGQAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASSGGGGYGPQGDYGQQGY GPQGAPTSFSNQM
Uniprot No.

Target Background

Function
Synaptophysin (SYP) likely plays structural roles in organizing membrane components and targeting vesicles to the plasma membrane. It is also implicated in the regulation of short-term and long-term synaptic plasticity.
Gene References Into Functions
  1. The structure of SYP has been determined. PMID: 17562317
Database Links

KEGG: bta:280937

STRING: 9913.ENSBTAP00000021428

UniGene: Bt.674

Protein Families
Synaptophysin/synaptobrevin family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, synaptosome.
Tissue Specificity
Characteristic of a type of small (30-80 nm) neurosecretory vesicles, including presynaptic vesicles, but also vesicles of various neuroendocrine cells of both neuronal and epithelial phenotype.

Q&A

What is bovine synaptophysin and what are its primary functions?

Synaptophysin is one of the two most abundant molecules found on synaptic vesicles (SVs), alongside synaptobrevin-II (sybII, also known as vesicle-associated membrane protein 2; VAMP2). It is an integral SV protein that plays a critical role in controlling the trafficking of sybII after SV fusion and its retrieval during endocytosis . Despite controlling key aspects of sybII packaging into SVs, the absence of synaptophysin results in surprisingly mild effects on neurotransmission under normal conditions . Its principal function appears to be mediating the efficient retrieval of sybII to sustain neurotransmitter release, particularly during periods of repetitive vesicle turnover when the synaptic machinery is under stress .

What expression systems are commonly used for recombinant bovine synaptophysin production?

Based on the research methodologies described in the literature, recombinant bovine synaptophysin is typically produced using either prokaryotic (E. coli) or eukaryotic expression systems (mammalian cell lines, insect cells). For functional studies, researchers frequently use neuronal cell cultures where synaptophysin can be expressed via transfection or viral transduction methods . In knockout/rescue experiments, primary cultures of hippocampal neurons from synaptophysin knockout mice are transfected with expression vectors containing the synaptophysin gene to restore function and study the protein's properties .

How stable is recombinant bovine synaptophysin during experimental manipulation?

Recombinant synaptophysin maintains sufficient stability for experimental use, particularly when expressed in neuronal cultures. Researchers successfully use the protein in extended protocols involving repeated stimulation trains and fluorescence imaging without significant degradation affecting experimental outcomes . For biochemical analyses, synaptophysin remains stable during cell fractionation procedures that separate synaptic vesicles from plasma membrane fractions, allowing for quantification by Western blotting techniques .

What structural features characterize bovine synaptophysin?

Synaptophysin is characterized as a transmembrane protein that spans the synaptic vesicle membrane. While the search results don't provide comprehensive structural details specific to the bovine variant, the protein has functionally important domains that interact with other synaptic components. Notably, synaptophysin appears to have binding regions that interact with peptide sequences derived from its structure, as demonstrated in studies where synaptophysin-derived peptides were identified from bovine brain digests . These peptides show biological activity in influencing protein structural conversions, suggesting functional domains within the synaptophysin sequence .

How does synaptophysin interact with synaptobrevin-II, and what experimental approaches reveal this interaction?

Synaptophysin plays a critical role in controlling synaptobrevin-II (sybII) trafficking and retrieval during synaptic vesicle recycling. This interaction is essential for maintaining presynaptic function, particularly during periods of high-frequency stimulation . The experimental approach to study this interaction typically involves:

  • Utilizing synaptophysin knockout neurons to observe the effects on sybII distribution and function

  • Employing optical imaging with fusion proteins such as vGLUT1-pHluorin to monitor synaptic vesicle exocytosis and endocytosis

  • Performing immunofluorescence and Western blotting to quantify sybII levels in different neuronal compartments

  • Conducting rescue experiments through transfection of exogenous synaptophysin or sybII

Research has demonstrated that in the absence of synaptophysin, neurons show a progressive decline in exocytic event amplitude during repeated stimulation, accompanied by reduced vesicular sybII levels . Importantly, this deficit can be rescued not only by reintroducing synaptophysin but also by expressing additional copies of sybII, indicating that synaptophysin's primary role is ensuring efficient sybII retrieval and recycling .

What is the relationship between synaptophysin and neurodegenerative disease processes?

Synaptophysin has connections to neurodegenerative disease processes, particularly through its relationship with proteins implicated in these conditions. One significant interaction involves synaptophysin-derived peptides and prion proteins. A study identified a peptide derived from synaptophysin that could accelerate structural conversions of recombinant bovine prion protein . This finding suggests synaptophysin may influence protein misfolding processes relevant to prion diseases such as bovine spongiform encephalopathy or Creutzfeld-Jakob disease .

Additionally, there appears to be a functional relationship between synaptophysin and α-synuclein, a protein centrally involved in Parkinson's disease pathology . Research indicates that these proteins may cooperate in regulating synaptic vesicle recycling, though the precise mechanisms require further investigation .

How do synaptophysin knockout models inform our understanding of synaptic vesicle dynamics?

Synaptophysin knockout models have provided crucial insights into the protein's function at the synapse. Interestingly, these models show surprisingly mild effects on basic neurotransmission parameters, with no overt defects in either evoked or spontaneous neurotransmission and only small perturbations in short-term plasticity under standard conditions . This initially puzzling observation led researchers to hypothesize that the large reservoir of synaptobrevin-II (approximately 70 copies per vesicle) combined with the minimal requirement of only 1-3 sybII molecules for vesicle fusion might mask functional deficits .

  • Progressive decline in the amplitude of exocytic events

  • Concomitant reduction in vesicular sybII levels

  • Deficits in sustaining presynaptic performance during repetitive stimulation

These findings indicate that synaptophysin's role becomes critical during periods of intense synaptic activity when efficient recycling of vesicle components is essential for maintaining neurotransmission .

What methods can be used to study synaptophysin's role in synaptic vesicle recycling?

Several sophisticated methodologies are employed to investigate synaptophysin's role in synaptic vesicle recycling:

  • pHluorin-based optical imaging: The most widely used approach involves synaptophysin-pHluorin (sypHy) or vGLUT1-pHluorin constructs. These pH-sensitive GFP variants are quenched at the acidic pH (~5.5) inside synaptic vesicles but fluoresce upon vesicle fusion when exposed to the neutral extracellular pH. This allows real-time monitoring of exocytosis and endocytosis .

  • Cell fractionation and biochemical analysis: Neurons are fractionated to separate synaptic vesicles from plasma membrane components, followed by Western blotting to quantify protein distribution between these compartments. This technique reveals changes in protein localization and recycling efficiency .

  • Immunofluorescence microscopy: Using antibodies against synaptophysin, synaptobrevin-II, or other synaptic proteins to visualize their distribution in cultured neurons under different stimulation conditions .

  • Knockout/rescue experiments: Genetic deletion of synaptophysin followed by reintroduction of wild-type or mutant forms to identify functionally important domains and interactions .

  • Co-immunoprecipitation: To study protein-protein interactions involving synaptophysin, such as its binding to synaptobrevin-II or interactions with synapsins .

What are the optimal conditions for monitoring synaptophysin function in primary neuronal cultures?

The optimal experimental conditions for studying synaptophysin function in primary neuronal cultures involve:

  • Culture preparation: Hippocampal neurons isolated from embryonic mice (typically E16-18) are plated at densities of 3–5 × 10^4 cells per coverslip on poly-D-lysine and laminin-coated surfaces. Cultures are maintained in Neurobasal media supplemented with B-27, 0.5 mM L-glutamine and 1% v/v penicillin/streptomycin .

  • Maturation time: Neurons are typically cultured for 13-16 days in vitro to ensure proper synapse formation and maturation before experimental manipulation .

  • Transfection timing: When introducing synaptophysin constructs or reporters like vGLUT1-pHluorin, transfection is performed at 7-8 days in vitro to allow sufficient expression by the time of experimental analysis .

  • Stimulation protocols: To reveal synaptophysin's functional role, neurons should be subjected to multiple rounds of stimulation. An effective protocol involves 4 trains of 300 action potentials delivered at 10 Hz (30 seconds per train) with 10-minute rest intervals between trains .

  • Imaging parameters: For pHluorin experiments, images are typically captured at 4-second intervals, with regions of interest placed over responsive nerve terminals. Fluorescence is normalized to the peak height of the first stimulus train, and NH₄Cl application at the end of the experiment reveals total vesicle pool size .

What technical challenges exist in studying synaptophysin-synaptobrevin interactions?

Several technical challenges complicate the study of synaptophysin-synaptobrevin interactions:

  • Abundance masking phenotypes: The high copy number of synaptobrevin-II on synaptic vesicles (approximately 70 copies) combined with the minimal requirement for fusion (1-3 molecules) means that deficits in sybII recycling may not be apparent under standard conditions. Researchers must use repeated stimulation protocols to reveal functional deficits .

  • Compensatory mechanisms: Synaptic systems have significant redundancy and compensatory capacity. In synaptophysin knockout models, other proteins may partially compensate for its absence, necessitating careful experimental design to reveal true functional deficits .

  • Temporal resolution limitations: While pHluorin-based imaging provides valuable information on vesicle dynamics, its temporal resolution (typically 4-second intervals) may not capture the fastest components of the vesicle cycle .

  • Protein-specific effects vs. general perturbations: Distinguishing specific effects of synaptophysin manipulation from general perturbations of synaptic function requires appropriate controls, such as rescue experiments with different protein variants .

  • Quantification challenges: Accurately quantifying synaptic proteins requires careful normalization and statistical analysis, particularly when comparing expression levels between different neuronal preparations .

How can researchers distinguish between direct and indirect effects of synaptophysin manipulation?

Distinguishing direct from indirect effects of synaptophysin manipulation requires multiple complementary approaches:

  • Acute vs. chronic manipulation: Comparing acute knockdown or inhibition of synaptophysin with chronic genetic deletion helps differentiate direct effects from compensatory responses.

  • Domain-specific mutations: Introducing mutations in specific synaptophysin domains can identify regions directly involved in particular functions while leaving others intact.

  • Rescue experiments: As demonstrated in the research, expressing either synaptophysin or synaptobrevin-II in knockout neurons can rescue presynaptic performance deficits. The fact that additional copies of sybII fully restored function suggests that synaptophysin's principal role is mediating efficient sybII retrieval .

  • Temporal correlation: Monitoring the time course of changes in multiple parameters (e.g., sybII levels, exocytosis amplitude, endocytosis kinetics) can reveal causal relationships.

  • Direct binding studies: Co-immunoprecipitation and other protein interaction assays can confirm direct physical interactions between synaptophysin and other synaptic proteins .

What quantification methods provide the most reliable data for synaptophysin functional studies?

The most reliable quantification methods for synaptophysin functional studies include:

  • Normalized fluorescence measurements: For pHluorin experiments, calculating ΔF/F₀ and normalizing to the peak height of the first stimulus train provides relative measures of exocytosis that can be compared across different experimental conditions .

  • Western blot quantification: For biochemical analyses, the ratio of protein in plasma membrane versus synaptic vesicle fractions (normalized to actin) provides a measure of protein distribution and recycling efficiency .

  • Immunofluorescence intensity analysis: Placing identically sized regions of interest over transfected and non-transfected synaptic puncta in the same field of view allows direct comparison of protein levels, with background subtraction to account for autofluorescence .

  • Decay kinetics analysis: Fitting the fluorescence decay portion of pHluorin responses to mathematical models provides quantitative measures of endocytosis rates .

  • Paired statistical analysis: When comparing different conditions within the same neuronal preparation, paired statistical tests provide greater power to detect meaningful differences while controlling for variability between cultures.

How does synaptophysin research inform therapeutic approaches for neurological disorders?

Research on synaptophysin has several implications for therapeutic development in neurological disorders:

  • Prion disease interventions: The discovery that synaptophysin-derived peptides can influence prion protein structural conversions suggests potential therapeutic targets. Understanding these interactions could lead to peptide-based or small molecule interventions that inhibit pathological protein misfolding in prion diseases .

  • Synaptopathies: Many neurological disorders involve synaptic dysfunction as a primary or secondary feature. As synaptophysin is essential for maintaining synaptic performance during periods of intense activity, therapeutics targeting synaptophysin function might help restore synaptic resilience in conditions characterized by synaptic failure .

  • Neuroprotective strategies: The interaction between synaptophysin and other synaptic proteins like α-synuclein suggests complex cooperative roles in maintaining synaptic health. Therapeutic approaches that preserve these interactions could potentially slow neurodegenerative processes .

  • Biomarker development: Changes in synaptophysin levels or post-translational modifications might serve as biomarkers for synaptic dysfunction in various neurological conditions.

What questions remain unanswered about synaptophysin's structural properties and interactions?

Despite significant advances, several questions about synaptophysin remain unanswered:

  • Structural determinants of function: Which specific structural domains of synaptophysin are critical for its interaction with synaptobrevin-II and other binding partners? While the research indicates binding occurs, the precise structural basis requires further investigation.

  • Post-translational modifications: How do phosphorylation and other post-translational modifications regulate synaptophysin function in different physiological and pathological states?

  • Isoform-specific functions: Are there tissue-specific or developmentally regulated isoforms of synaptophysin with distinct functional properties?

  • Dynamic structural changes: Does synaptophysin undergo conformational changes during the synaptic vesicle cycle that regulate its interactions with other proteins?

  • Species-specific variations: What structural and functional differences exist between bovine synaptophysin and its counterparts in other species, particularly humans?

How can recombinant bovine synaptophysin be used in high-throughput screening for neuroactive compounds?

Recombinant bovine synaptophysin could be utilized in high-throughput screening through several approaches:

  • Fluorescence-based interaction assays: Developing assays that monitor the interaction between synaptophysin and its binding partners (e.g., synaptobrevin-II) using fluorescence resonance energy transfer (FRET) or related techniques could identify compounds that modulate these interactions.

  • Vesicle recycling screens: Using synaptophysin-pHluorin (sypHy) in neuronal cultures to screen for compounds that enhance vesicle recycling efficiency, particularly under conditions of repeated stimulation.

  • Protein misfolding prevention: Given the interaction between synaptophysin-derived peptides and prion proteins, screening for compounds that modulate this interaction could identify potential therapeutics for protein misfolding diseases .

  • Binding competition assays: Using labeled synaptophysin peptides to screen for compounds that compete for binding to target proteins like prions or α-synuclein.

  • Activity-dependent trafficking: Developing assays that monitor synaptophysin trafficking in response to neuronal activity could identify compounds that enhance or inhibit specific aspects of this process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.