Recombinant Bovine Syntaxin-17 (STX17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please inform us of any specific tag requirements for preferential development.
Synonyms
STX17; Syntaxin-17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MSEDEEKVKLRRLEPAIQKFTKIVIPTDLERLRKHQINIEKYQRCRVWDKLHEEHINAGR TVQQLRSNIREMEKLCLKVRKDDLGLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQF NDEETFLQPSLTRSMTVGGTFHSTEDEADPQSMTQIYALPEIPRDQNAAESWETLEADLI ELSQLVTDFSLLVNSQQEKIDSIEDHVNTAAVNVEEGTKNLGKAAKYKLAALPVAGALIG GVVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRRKQKMMEKLASSCPDLPSQTDKK CS
Uniprot No.

Target Background

Function
Syntaxin-17 (STX17) is a SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein crucial for cellular membrane fusion. STX17, located on autophagosome membranes, participates in autophagy by directly regulating the fusion of autophagosomes with lysosomes. It may also play a role in the early secretory pathway, potentially maintaining the architecture of the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and Golgi apparatus, and/or regulating transport between the endoplasmic reticulum, ERGIC, and Golgi.
Database Links
Protein Families
Syntaxin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Smooth endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein. Cytoplasm, cytosol.

Q&A

What is Syntaxin-17 and what are its primary biological functions?

Syntaxin-17 (STX17) is a SNARE (Soluble N-ethylmaleimide-sensitive factor Attachment protein REceptor) protein that functions in multiple membrane trafficking pathways. STX17 has been implicated in at least two major cellular processes: autophagosome-lysosome fusion and protein complex assembly during autophagy initiation. Recent research has revealed that STX17 is phosphorylated by TBK1 (TANK-binding kinase 1), and this phosphorylated form controls the formation of ATG13-containing complexes essential for early autophagy events . Additionally, STX17 is abundantly expressed in steroidogenic tissues and specifically localizes to smooth membranes of the endoplasmic reticulum, suggesting a specialized role in steroid-producing cells .

What are the key structural features of bovine STX17?

Bovine STX17, like its counterparts in other species, is characterized by:

  • A cytoplasmic N-terminal domain

  • A SNARE motif for interaction with other SNARE proteins

  • Two adjacent hydrophobic domains near its C-terminus that anchor it to membranes

  • A C-terminal sequence (KKCS) that serves as an ER retrieval signal

The unusual membrane anchoring mechanism of STX17 involves two adjacent hydrophobic domains at its C-terminus, unlike most SNAREs that typically have a single transmembrane domain. This unique structural feature may be critical for its specialized localization to smooth ER membranes in steroidogenic cells .

How does bovine STX17 expression compare across different tissues?

STX17 exhibits differential expression across bovine tissues, with particularly high abundance in steroidogenic organs:

Tissue TypeRelative STX17 ExpressionNotes
Adrenal CortexVery HighPredominantly in cortical cells involved in steroid hormone production
Adrenal MedullaModerateLower than cortex
TestisVery HighSpecifically in testosterone-secreting Leydig cells
OvaryHighIn steroidogenic cells
PlacentaHighIn hormone-producing cells
LiverHighThroughout hepatocytes
Other tissuesLowDetectable but significantly reduced levels

This expression pattern strongly correlates with steroidogenic function, suggesting a specialized role for STX17 in cells involved in steroid hormone synthesis .

How does phosphorylation of STX17 by TBK1 regulate autophagy initiation?

STX17 phosphorylation by TBK1 represents a critical regulatory mechanism for autophagy initiation. This process occurs as follows:

  • TBK1 interacts directly with STX17, as demonstrated by co-immunoprecipitation experiments

  • TBK1 phosphorylates STX17 specifically at serine-202 (Ser-202)

  • This phosphorylation induces a band shift that can be detected by electrophoretic mobility analysis

  • Phosphorylated STX17 (pS202) localizes predominantly to the Golgi apparatus

  • Upon autophagy induction, pS202-STX17 translocates from the Golgi to peripheral puncta

  • Only phosphorylated or phosphomimetic STX17 (S202D) can effectively interact with autophagy initiation proteins ATG13 and FIP200

  • This interaction is essential for mammalian PAS (pre-autophagosomal structure) formation

The phosphorylation-dependent translocation and protein interaction capabilities of STX17 position it as a critical regulator of early autophagy events, not just the later fusion steps as previously thought.

What is the temporal regulation mechanism of STX17 recruitment to mature autophagosomes?

The recruitment of STX17 to autophagosomes is strictly temporally regulated to ensure that only fully closed autophagosomes fuse with lysosomes, preventing potential leakage of lysosomal enzymes into the cytosol. Recent research has revealed:

  • STX17 recruitment requires positively charged amino acids in its C-terminal region

  • Mature autophagosomes become more negatively charged when they acquire STX17

  • Phosphatidylinositol 4-phosphate (PI4P), a negatively charged phospholipid, accumulates during autophagosome maturation

  • PI4P is required for STX17 recruitment through electrostatic interactions

  • This represents a novel mechanism for temporal control of autophagosome-lysosome fusion

These findings suggest that the electrostatic properties of autophagosomal membranes change during maturation, creating a molecular switch that permits STX17 recruitment only when autophagosomes are fully closed and ready for fusion with lysosomes.

How can researchers effectively analyze STX17 phosphorylation states?

To analyze STX17 phosphorylation states, researchers should consider the following methodological approaches:

  • Phospho-specific antibody detection:

    • Utilize antibodies specifically recognizing phosphorylated Ser-202 of STX17

    • Apply in both Western blot and immunofluorescence microscopy contexts

    • Compare with total STX17 antibodies to determine phosphorylation ratio

  • Electrophoretic mobility shift assay:

    • Phosphorylated STX17 exhibits lower electrophoretic mobility

    • Detect band shifts using SDS-PAGE followed by Western blotting

    • Include λ-phosphatase treatment controls to confirm phosphorylation

  • Mass spectrometry analysis:

    • Immunoprecipitate STX17 from cells under different conditions

    • Perform LC-MS/MS to identify phosphorylation sites

    • Quantify phosphopeptide abundance using approaches like TMT labeling

  • Phosphomimetic and phospho-dead mutants:

    • Generate S202D (phosphomimetic) and S202A (phospho-dead) STX17 mutants

    • Use these constructs to validate functional significance of phosphorylation

    • Compare localization and protein interaction patterns between variants

What protein complexes does STX17 form during different cellular processes?

STX17 participates in multiple protein complexes depending on cellular context and activation state:

Complex ComponentsCellular ProcessDetection MethodFunctional Significance
STX17-TBK1Autophagy initiationCo-IP, proteomicsEnables STX17 phosphorylation
STX17(pS202)-ATG13-FIP200PAS formationCo-IPCritical for autophagy initiation
STX17-SNAP29-VAMP7/8Autophagosome-lysosome fusionCo-IP, FRETMediates membrane fusion
STX17-rsly1ER membrane traffickingCo-IPRegulates ER membrane dynamics
STX17-rsec22b-rbet1Intermediate compartment traffickingCo-IPInvolved in ER-Golgi transport

These distinct complexes highlight STX17's versatility in cellular membrane trafficking events and suggest context-dependent regulation of its interaction partners .

What are the optimal expression systems for producing functional recombinant bovine STX17?

Producing functional recombinant bovine STX17 requires careful consideration of expression systems to ensure proper folding and post-translational modifications:

  • Bacterial expression systems:

    • Suitable for N-terminal cytoplasmic domain (amino acids 1-227)

    • Expression as GST-fusion proteins enhances solubility

    • Thrombin cleavage can be used to separate from GST tag

    • Limited utility for full-length protein due to membrane domains

  • Insect cell expression systems:

    • Preferred for full-length STX17 with hydrophobic domains

    • Baculovirus-infected Sf9 or High Five cells provide eukaryotic processing

    • Can incorporate tags like mGFP for visualization

    • Successfully used for producing mGFP-STX17TM constructs

  • Mammalian cell expression:

    • Optimal for studies requiring authentic post-translational modifications

    • HEK293 cells can express FLAG-tagged or GFP-tagged STX17

    • Allows for direct visualization in trafficking studies

    • Essential for phosphorylation studies with TBK1

The choice of expression system should be guided by the intended experimental application and whether membrane integration or specific post-translational modifications are required.

What challenges exist in purifying functional recombinant STX17 with proper membrane integration properties?

Purifying functional recombinant STX17 presents several technical challenges:

  • Hydrophobic domain management:

    • The dual hydrophobic domains near the C-terminus create aggregation issues

    • Detergent screening is critical (typically CHAPS, DDM, or digitonin)

    • Lipid additives may be necessary to maintain native conformation

  • Conformational integrity:

    • Ensuring the protein adopts native conformation after purification

    • Circular dichroism analysis can confirm secondary structure integrity

    • Functional assays should verify SNARE complex formation capability

  • Post-translational modification preservation:

    • Phosphorylation states may be lost during purification

    • Phosphatase inhibitors must be included throughout the process

    • Verification via phospho-specific antibodies is essential

  • Scale-up considerations:

    • Production at research-scale quantities (1-5 mg) is feasible

    • Consistent batch-to-batch reproducibility requires standardized protocols

    • Stability during storage often requires specialized buffer conditions with glycerol and reducing agents

How can recombinant bovine STX17 be effectively used in structural studies?

For structural characterization of recombinant bovine STX17:

  • X-ray crystallography approach:

    • Focus on the cytoplasmic domain (amino acids 1-227) for initial studies

    • Construct design should exclude hydrophobic domains for crystallization

    • Screening multiple constructs with varied N- and C-terminal boundaries

    • Co-crystallization with interaction partners (ATG13 fragments, SNAP29) may stabilize structure

  • Cryo-EM analysis:

    • Suitable for full-length STX17 in membrane environments

    • Reconstitution into nanodiscs or liposomes to maintain native conformation

    • Use of Fab fragments as fiducial markers can improve particle alignment

    • Focus on STX17-containing SNARE complexes for functional insights

  • NMR spectroscopy:

    • Applicable to smaller domains (SNARE motif, N-terminal region)

    • 15N/13C labeling in minimal media for bacterial expression

    • Study of protein dynamics and phosphorylation-induced conformational changes

    • Interaction mapping with binding partners at atomic resolution

What methodologies are recommended for studying STX17's role in autophagy using recombinant proteins?

To investigate STX17's autophagy functions using recombinant proteins:

  • In vitro reconstitution assays:

    • Isolate mature autophagosomes from STX17 knockout cells

    • Add recombinant STX17 proteins (wild-type, S202A, or S202D variants)

    • Assess recruitment to autophagosomal membranes via microscopy or sedimentation assays

    • Test effects of phosphatidylinositol phosphates (particularly PI4P) on recruitment

  • SNARE complex assembly analysis:

    • Use purified recombinant STX17, SNAP29, and VAMP7/8

    • Monitor complex formation via native PAGE, size exclusion chromatography

    • Assess how phosphorylation affects complex stability and kinetics

    • Membrane fusion assays with fluorescently labeled liposomes

  • Protein-protein interaction mapping:

    • Pull-down assays with immobilized STX17 variants

    • Identify interaction partners from cell lysates

    • Confirm direct interactions with purified components

    • Quantify binding affinities via surface plasmon resonance or isothermal titration calorimetry

These methodologies provide complementary approaches to dissect STX17's molecular functions in autophagy regulation, from early initiation events through to autophagosome-lysosome fusion.

How can researchers address problems with recombinant STX17 aggregation during purification?

Aggregation of recombinant STX17 is a common challenge due to its hydrophobic domains. To minimize this issue:

  • Optimization of detergent conditions:

    • Test a panel of mild detergents (CHAPS, DDM, Brij-35)

    • Include initial screening at 5-10 different concentrations

    • Consider mixed micelle systems with lipids for improved stability

    • Monitor aggregation via dynamic light scattering during purification

  • Construct design approaches:

    • Remove C-terminal hydrophobic domains for soluble variants

    • Use fusion partners that enhance solubility (MBP, SUMO, thioredoxin)

    • Consider split-domain approaches for separate expression and reconstitution

    • Test truncated constructs that maintain essential functional domains

  • Buffer optimization strategy:

    • Include 5-10% glycerol to stabilize protein structure

    • Test pH range from 6.8-8.0 for optimal stability

    • Include reducing agents (DTT or TCEP) to prevent disulfide formation

    • Consider amino acid additives (arginine, proline) known to reduce aggregation

What controls should be included when studying phosphorylation-dependent functions of STX17?

When investigating phosphorylation-dependent STX17 functions, these controls are essential:

  • Phospho-variant controls:

    • Include phosphomimetic (S202D) STX17 as positive control

    • Include phospho-dead (S202A) STX17 as negative control

    • Wild-type STX17 with and without active TBK1 kinase

    • TBK1 kinase-dead mutant (K38D) as enzymatic control

  • Phosphorylation verification:

    • Phospho-specific antibody detection alongside total STX17 antibodies

    • Mass spectrometry confirmation of modification sites

    • λ-phosphatase treatment to remove phosphorylation

    • Mobility shift analysis on Phos-tag or standard SDS-PAGE gels

  • Functional validation:

    • Rescue experiments in STX17-knockout backgrounds

    • Comparative analysis of all variants for subcellular localization

    • Protein-protein interaction profiles of different variants

    • Autophagy flux measurements with each variant

These comprehensive controls ensure that observed phenotypes can be confidently attributed to the phosphorylation state of STX17 rather than to other variables or artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.