Recombinant Bovine TBC1 domain family member 20 (TBC1D20)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but customers may adjust as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
TBC1D20; TBC1 domain family member 20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TBC1D20
Target Protein Sequence
MALRSARGDGPTSGRWDGGAEKGDFNAKRKKKVAEIYQALNSEPTDVAALRRMAISEGGL LTDEIRRKVWPKLLNVNTNDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQRE GLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVLGERLATSLVEKLSTHHLRDFMDP TMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYD FFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFV QFPPSELAREAAAQPQAEKTAASTFKDFELASAQQRPDMVLRQRFRGLLRPDERTKDVLT KPRTNRFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP
Uniprot No.

Target Background

Function
Recombinant Bovine TBC1 domain family member 20 (TBC1D20) is a GTPase-activating protein (GAP) specific to the Rab1 and Rab2 small GTPase families. It significantly accelerates the intrinsic GTP hydrolysis rate of these GTPases, by more than five orders of magnitude.
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TBC1D20 and what are its primary cellular functions?

TBC1D20 is a member of the TBC1 domain family that functions as a GTPase-activating protein (GAP) specifically for RAB1 and RAB2 GTPases . Its primary cellular function involves regulating protein trafficking between the endoplasmic reticulum (ER) and Golgi apparatus, a critical pathway in the secretory system .

Through its GAP activity, TBC1D20 inactivates RAB1 and RAB2, thereby modulating vesicular transport. This regulation is essential for maintaining proper organelle structure and function, particularly of the ER and Golgi complex. Dysfunction in TBC1D20 leads to enlarged Golgi morphology and aberrant lipid droplet formation, as observed in mouse embryonic fibroblasts from TBC1D20-deficient mice .

Additionally, TBC1D20 plays crucial roles in:

  • Reproductive development and fertility in both males and females

  • Eye development, with mutations leading to cataracts

  • Viral protein trafficking, including HIV-1 envelope proteins

How is bovine TBC1D20 structurally and functionally similar to human and mouse orthologs?

Bovine TBC1D20 shares significant structural and functional similarities with human and mouse orthologs, making it a valuable research model. While the search results don't provide specific sequence homology percentages, functional studies demonstrate conservation of the critical TBC domain responsible for RAB-GAP activity across species .

The functional conservation is evidenced by:

  • Consistent roles in regulating ER-to-Golgi trafficking across mammalian species

  • Similar phenotypic outcomes when TBC1D20 is mutated or depleted, including reproductive and developmental defects

  • Cross-species recognition by antibodies and research reagents

Researchers working with recombinant bovine TBC1D20 can generally apply insights from mouse and human studies, though species-specific differences in regulation and interaction partners may exist and should be experimentally validated.

What experimental models have been established to study TBC1D20 function?

Several experimental models have been established to study TBC1D20 function across different physiological contexts:

  • The blind sterile (bs) mouse model: A spontaneous TBC1D20 loss-of-function mouse model that exhibits congenital cataracts and reproductive defects. This model has been instrumental in revealing TBC1D20's roles in development .

  • Cell culture systems:

    • Mouse embryonic fibroblasts (mEFs) from TBC1D20-deficient mice

    • Primary uterine stromal cells for studying decidualization

    • Cell lines for studying viral trafficking

  • In vitro biochemical assays:

    • Recombinant protein systems for studying TBC1D20's GAP activity

    • Protein-protein interaction studies to identify binding partners

  • Tissue-specific analyses:

    • Reproductive tract development studies

    • Cellular trafficking assays using fluorescently tagged proteins

These diverse models enable researchers to investigate TBC1D20's function from molecular to organismal levels, providing complementary insights into its biological roles and regulatory mechanisms.

How does TBC1D20 deficiency impact reproductive development and fertility?

TBC1D20 deficiency has profound effects on reproductive development and fertility in both male and female mammals, though through distinct mechanisms.

Female reproductive impacts:
Female mice lacking functional TBC1D20 (Tbc1d20−/− mice) exhibit complete infertility . Interestingly, the primary cause is not ovarian dysfunction or fallopian tube abnormalities, as these structures appear normal. Early embryo implantation also occurs successfully . Instead, the infertility stems from:

  • Impaired postnatal uterine development:

    • Significant reduction in uterine size and weight

    • Decreased myometrial thickness

    • Reduced number of endometrial glands

    • Lower density of blood vessels

  • Defective decidualization:

    • Impaired uterine decidualization response in vivo

    • Decreased expression of decidualization marker genes (Bmp2, Bmp4, Hoxa10, Pgr, and Wnt4)

    • Retarded proliferation and differentiation of uterine stromal cells in vitro

Male reproductive impacts:
Male Tbc1d20−/− mice are sterile, exhibiting:

  • Gonadal dysplasia

  • Impaired blood-testis barrier integrity

  • Sertoli cell viability issues

Molecular mechanism:
The underlying cause appears to be endoplasmic reticulum (ER) stress triggered by TBC1D20 deficiency, as evidenced by:

  • Increased expression of ER stress markers (CHOP, IRE1α, P-PERK, and P-eIF2α)

  • Disrupted protein trafficking through the ER-Golgi network

  • Subsequent cellular dysfunction and developmental abnormalities

This research highlights TBC1D20's essential role in mammalian reproductive development through regulation of cellular trafficking and ER homeostasis.

What role does TBC1D20 play in viral replication cycles?

TBC1D20 has emerged as an important factor in viral replication cycles, particularly for HIV-1. Its role in regulating ER-to-Golgi trafficking directly impacts viral protein processing and maturation.

For HIV-1, TBC1D20's involvement is particularly notable:

  • Envelope protein trafficking regulation:

    • TBC1D20 modulates the early trafficking of HIV-1 envelope proteins through the secretory pathway

    • Overexpression of TBC1D20 hampers envelope processing

  • Impact on viral particle infectivity:

    • Excessive TBC1D20 activity reduces envelope protein association with detergent-resistant membranes

    • This leads to reduced infectivity of HIV-1 virion-like particles (VLPs)

  • Host factor network:

    • TBC1D20 functions as part of the network of host factors regulating the HIV replication cycle

    • Interestingly, it was not identified in previous extensive RNAi screens for HIV-dependency factors, highlighting the need for diverse experimental approaches

This research suggests potential therapeutic strategies targeting host cell trafficking mechanisms rather than viral proteins directly, which could provide alternatives to combat viral resistance to conventional antivirals.

The precise mechanisms by which TBC1D20 affects other viral replication cycles remain areas for future investigation, particularly given its fundamental role in the secretory pathway used by many enveloped viruses.

How does TBC1D20 function as a RAB-GTPase activating protein (GAP) at the molecular level?

TBC1D20 functions as a GTPase-activating protein (GAP) specifically for RAB1 and RAB2, small GTPases that regulate vesicular trafficking. At the molecular level, this function involves several key processes:

  • Catalytic mechanism:

    • TBC1D20 contains a TBC (Tre-2/Bub2/Cdc16) domain that accelerates the intrinsic GTPase activity of RAB1 and RAB2

    • This catalytic activity converts RAB1/2 from their active GTP-bound state to their inactive GDP-bound state

    • The process involves a dual-finger mechanism with conserved arginine and glutamine residues for GTP hydrolysis

  • Specificity determinants:

    • Despite the conservation of the TBC domain across family members, TBC1D20 exhibits high specificity for RAB1 and RAB2

    • This specificity is determined by protein-protein interaction surfaces and recognition motifs outside the catalytic site

    • The selectivity ensures proper regulation of specific trafficking pathways

  • Structural requirements:

    • TBC1D20 contains a C-terminal transmembrane domain that anchors it to the ER membrane

    • This localization is crucial for its function in regulating ER-to-Golgi trafficking

    • The spatial positioning allows precise control over RAB activation states at specific membrane interfaces

  • Functional consequences:

    • By inactivating RAB1/2, TBC1D20 controls the formation and movement of transport vesicles

    • This regulation is essential for maintaining Golgi structure and function

    • Deficiency leads to enlarged Golgi morphology and aberrant lipid droplet formation

The molecular understanding of TBC1D20's GAP activity provides insights into how mutations can lead to the diverse phenotypes observed in TBC1D20-deficient models, from reproductive abnormalities to cataracts and viral trafficking defects.

What expression systems are recommended for producing functional recombinant bovine TBC1D20?

Based on research practices and available commercial products, several expression systems can be used to produce functional recombinant bovine TBC1D20:

  • Cell-free expression systems:

    • Commercial recombinant bovine TBC1D20 is produced using cell-free expression systems

    • Advantages include rapid production, ability to express toxic proteins, and simplified purification

    • This approach yields protein with greater than or equal to 85% purity as determined by SDS-PAGE

  • Mammalian cell expression:

    • Recommended for studies requiring post-translational modifications

    • HEK293 or CHO cells are commonly used for mammalian protein expression

    • Codon optimization for bovine sequences may improve expression levels

  • Bacterial expression systems:

    • E. coli-based systems (particularly BL21(DE3) strains) can be used for expressing functional domains

    • May require optimization of induction conditions (temperature, IPTG concentration)

    • Often results in inclusion bodies requiring refolding for full-length TBC1D20

  • Insect cell expression:

    • Baculovirus expression systems offer a compromise between proper folding and yield

    • Suitable for structural studies requiring higher protein yields than mammalian systems

Recommended approach for functional studies:
For studies requiring functional GAP activity, the choice depends on the specific research question:

  • For structural studies: Insect cell or cell-free systems

  • For interaction studies: Mammalian expression preserving native conformations

  • For enzymatic assays: Cell-free systems with appropriate buffer optimization

Regardless of system choice, verification of proper folding and activity through functional assays is essential before proceeding with experimental applications.

What are the optimal methods for assessing TBC1D20's GAP activity in vitro?

Assessing TBC1D20's GAP activity in vitro requires measuring its ability to accelerate GTP hydrolysis by its target RAB GTPases. Several complementary approaches can be employed:

  • Colorimetric phosphate release assays:

    • Measure inorganic phosphate released during GTP hydrolysis

    • Malachite green assay: Quantifies phosphate through color change measurable at 620-650nm

    • Benefits: Straightforward, adaptable to plate readers for higher throughput

  • HPLC-based nucleotide analysis:

    • Separates and quantifies GDP and GTP

    • Directly measures conversion from GTP to GDP

    • Benefits: Highly accurate, avoids artifacts from other phosphate-generating reactions

  • Fluorescent GTP analogs:

    • Uses BODIPY-FL-GTP or other fluorescent GTP analogs

    • Changes in fluorescence upon hydrolysis indicate GAP activity

    • Benefits: Real-time measurement capability, higher sensitivity

  • Radioactive assays:

    • Uses [γ-32P]GTP or [α-32P]GTP

    • Measures release of labeled phosphate or conversion to GDP

    • Benefits: Gold standard for sensitivity, though has safety and disposal considerations

Experimental protocol outline:

  • Purify recombinant TBC1D20 and target RAB GTPases (typically RAB1 and RAB2)

  • Load RAB proteins with appropriate GTP substrate

  • Incubate with various concentrations of TBC1D20

  • Measure GTP hydrolysis rate using one of the methods above

  • Calculate kinetic parameters (kcat/KM)

Essential controls:

  • RAB GTPase alone (intrinsic hydrolysis rate)

  • Known GAP protein as positive control

  • Catalytically inactive TBC1D20 mutant

  • Non-target RAB as specificity control

Data presentation:
Results should be presented as fold-acceleration of GTP hydrolysis over intrinsic rate, or as absolute kinetic parameters when detailed enzymology is performed.

What cellular assays best demonstrate TBC1D20's function in membrane trafficking?

To evaluate TBC1D20's function in membrane trafficking, researchers can employ several cell-based assays that visualize or quantify different aspects of ER-to-Golgi transport:

  • Vesicular Stomatitis Virus G protein (VSVG) trafficking assay:

    • The temperature-sensitive VSVG-GFP fusion protein accumulates in the ER at non-permissive temperature (40°C)

    • Upon shift to permissive temperature (32°C), synchronized trafficking through the secretory pathway occurs

    • Timeline of VSVG localization under normal vs. TBC1D20-manipulated conditions reveals trafficking defects

    • Quantification: Percent of cells showing ER, ER-Golgi intermediate compartment, Golgi, or plasma membrane localization

  • Golgi morphology analysis:

    • Immunofluorescence staining of Golgi markers (GM130, TGN46, etc.)

    • TBC1D20 dysfunction leads to enlarged Golgi morphology

    • Quantification: Golgi area, fragmentation index, or circularity measurements

  • Protein secretion assays:

    • Measure secretion of reporter proteins (e.g., secreted alkaline phosphatase, luciferase)

    • Pulse-chase experiments with radiolabeled proteins

    • Quantification: Percentage of reporter secreted over time

  • HIV-1 envelope protein trafficking:

    • Track HIV-1 envelope protein processing and surface expression

    • TBC1D20 overexpression hampers envelope processing and reduces its association with detergent-resistant membranes

    • Quantification: Ratio of processed to unprocessed envelope, surface vs. intracellular distribution

  • Endoplasmic reticulum stress markers:

    • Immunoblotting for ER stress indicators induced by trafficking defects

    • TBC1D20 deficiency triggers increased expression of CHOP, IRE1α, P-PERK, and P-eIF2α

    • Quantification: Relative expression levels normalized to housekeeping genes

Experimental design considerations:

  • Use both gain-of-function (overexpression) and loss-of-function (siRNA knockdown) approaches

  • Include rescue experiments with wild-type vs. catalytically inactive TBC1D20

  • Employ live-cell imaging when possible to capture trafficking dynamics

  • Combine imaging with biochemical fractionation for comprehensive analysis

These assays provide complementary information about TBC1D20's roles in different aspects of membrane trafficking and organelle homeostasis.

How can recombinant TBC1D20 contribute to reproductive biology research?

Recombinant TBC1D20 offers multiple applications for advancing reproductive biology research, particularly given its essential roles in both male and female fertility:

  • Uterine development research:

    • Recombinant TBC1D20 can serve as a standard in biochemical assays examining protein interactions in uterine tissue

    • Useful for identifying novel binding partners in reproductive tissues through pull-down assays

    • Research has shown TBC1D20 is necessary for normal postnatal uterine development and endometrial decidualization in mice

  • Biomarker development:

    • Quantitative assays measuring TBC1D20 levels or activity could potentially serve as biomarkers for certain fertility conditions

    • The established TBC1D20−/− mouse model shows marked reduction in uterine size and weight, impaired myometrial thickness, reduced endometrial glands, and decreased blood vessel density

  • Cell-based models of decidualization:

    • Recombinant TBC1D20 can be used in rescue experiments in TBC1D20-deficient uterine stromal cells

    • In vitro studies show TBC1D20 deficiency retards proliferation and differentiation of uterine stromal cells

    • Experimental data shows significantly decreased EdU-positive uterine stromal cells lacking functional TBC1D20, indicating impaired DNA synthesis

  • Mechanistic studies of endoplasmic reticulum stress in reproduction:

    • Recombinant protein can help elucidate how TBC1D20 prevents ER stress in reproductive tissues

    • Research demonstrates TBC1D20 deficiency triggers increased expression of ER stress markers like CHOP, IRE1α, P-PERK and P-eIF2α

  • Male fertility research:

    • Studies in the blood-testis barrier integrity using recombinant TBC1D20

    • Investigation of Sertoli cell viability mechanisms

Table 1: Reproductive Phenotypes Associated with TBC1D20 Deficiency

SexFertility StatusPrimary DefectsMolecular MechanismsReference
FemaleInfertileReduced uterine size, fewer endometrial glands, impaired decidualizationER stress, decreased expression of Bmp2, Bmp4, Hoxa10, Pgr, Wnt4
MaleSterileGonadal dysplasia, blood-testis barrier defectsER stress, Sertoli cell viability issues

This comprehensive approach using recombinant TBC1D20 can advance our understanding of molecular mechanisms underlying infertility and potentially lead to novel therapeutic strategies.

What insights can TBC1D20 research provide for understanding membrane trafficking disorders?

TBC1D20 research offers significant insights into membrane trafficking disorders, particularly those involving the ER-Golgi interface, providing both mechanistic understanding and potential therapeutic approaches:

  • Warburg Micro syndrome (WARBM):

    • TBC1D20 mutations cause WARBM4, a rare autosomal recessive disorder

    • The blind sterile (bs) mouse model with TBC1D20 deficiency exhibits typical WARBM phenotypes including congenital cataracts and gonadal abnormalities

    • Research demonstrates that these phenotypes result from disrupted ER-Golgi trafficking

  • Mechanisms of organelle homeostasis:

    • TBC1D20's role as a RAB1/RAB2 GAP illuminates how trafficking defects lead to organelle structural abnormalities

    • Studies in mouse embryonic fibroblasts (mEFs) with TBC1D20 deficiency show enlarged Golgi morphology and aberrant lipid droplet formation

    • This provides mechanistic insight into how trafficking disruptions manifest as disease phenotypes

  • ER stress-related disorders:

    • TBC1D20 deficiency triggers endoplasmic reticulum stress in various cell types

    • This mechanism may contribute to numerous conditions including neurodegenerative diseases, diabetes, and inflammatory disorders

    • Research shows increased expression of ER stress markers (CHOP, IRE1α, P-PERK, P-eIF2α) in TBC1D20-deficient cells

  • Tissue-specific trafficking requirements:

    • Different tissues show varied sensitivity to TBC1D20 dysfunction

    • The eye lens and reproductive tissues appear particularly vulnerable

    • This tissue specificity helps explain the selective manifestation of symptoms in trafficking disorders

  • Viral pathogenesis:

    • Research on HIV-1 shows that TBC1D20 regulates envelope protein trafficking

    • This connection between host trafficking machinery and viral exploitation offers insights into viral pathogenesis mechanisms

    • Excessive TBC1D20 activity perturbs HIV-1 envelope trafficking and reduces viral infectivity

By studying TBC1D20's function across different cellular contexts, researchers can develop more targeted approaches to address trafficking defects in specific disorders, potentially leading to therapeutic strategies focused on modulating RAB GTPase cycling or mitigating downstream consequences of trafficking disruption.

What are common technical challenges when working with recombinant TBC1D20 and how can they be addressed?

Researchers working with recombinant TBC1D20 frequently encounter several technical challenges. Here are the most common issues and recommended solutions:

  • Protein solubility issues:

    • Challenge: Full-length TBC1D20 contains a transmembrane domain that can cause aggregation

    • Solution: Consider expressing truncated versions lacking the transmembrane domain for soluble protein

    • Alternative: Use detergent solubilization (mild non-ionic detergents like DDM or CHAPS)

    • Optimization: Screen protein expression at lower temperatures (16-18°C) to improve folding

  • Maintaining enzymatic activity:

    • Challenge: Loss of GAP activity during purification or storage

    • Solution: Include glycerol (10-20%) and reducing agents in storage buffers

    • Validation: Always confirm activity with functional assays before experimental use

    • Storage: Aliquot and flash-freeze to avoid freeze-thaw cycles

  • Specificity validation:

    • Challenge: Ensuring observed effects are due to TBC1D20's GAP activity

    • Solution: Include catalytically inactive mutant (R105A) as negative control

    • Validation: Test activity against non-target RABs as specificity controls

    • Controls: Commercial recombinant protein should be tested for purity (≥85% by SDS-PAGE)

  • Antibody cross-reactivity:

    • Challenge: Antibody specificity concerns across species

    • Solution: Validate antibodies using knockout/knockdown controls

    • Alternative: Consider epitope-tagged recombinant proteins

    • Resources: Commercial antibodies specifically validated for various applications (WB, IHC, IF) are available

  • Reproducibility between preparations:

    • Challenge: Batch-to-batch variation in activity

    • Solution: Standardize expression and purification protocols

    • Quantification: Develop robust activity assays for quality control

    • Reference: Use commercial standards where possible (>95% purity for antibody reagents)

Table 2: Troubleshooting Guide for Common TBC1D20 Experimental Issues

IssuePossible CauseSolutionValidation Method
Low protein yieldToxicity to expression hostUse cell-free expression systems SDS-PAGE, protein quantification
Loss of activityProtein misfoldingOptimize buffer conditions, add stabilizersGAP activity assay
Non-specific effectsOff-target interactionsInclude appropriate controls, use siRNA validation Parallel experiments with control siRNA
Inconsistent resultsBatch variationStandardize protocols, include internal standardsStandard curve with known activity
Poor antibody performanceEpitope inaccessibilityTry multiple antibodies targeting different regions Western blot with positive control

By anticipating these challenges and implementing the suggested solutions, researchers can improve the reliability and reproducibility of experiments using recombinant bovine TBC1D20.

What considerations are important when designing TBC1D20 knockdown or knockout experiments?

Designing effective TBC1D20 knockdown or knockout experiments requires careful planning to ensure valid, interpretable results. Here are key considerations:

  • Choice of experimental system:

    • Cell lines: Choose relevant to research question (e.g., reproductive tissue-derived for fertility studies)

    • Primary cells: Consider using primary uterine stromal cells as demonstrated in previous research

    • Animal models: The established blind sterile (bs) mouse model provides a validated TBC1D20-deficient system

    • Comparison: Include wild-type (Tbc1d20+/+) controls alongside heterozygous and homozygous mutants

  • Knockdown approaches:

    • siRNA selection: Commercial validated siRNAs for TBC1D20 are available with >97% purification standard

    • Target specificity: Design siRNAs to avoid off-target effects; use multiple independent siRNAs

    • Knockdown validation: Confirm reduction at both mRNA (qRT-PCR) and protein (Western blot) levels

    • Timing: Consider TBC1D20's half-life when determining optimal time points for analysis post-knockdown

  • Knockout strategies:

    • Complete vs. conditional knockout: Consider whether developmental effects might mask adult phenotypes

    • Tissue-specific knockout: Use appropriate Cre-driver lines for tissue-specific deletion

    • Verification: Confirm knockout by genotyping, mRNA analysis, and protein expression

    • Background strain: The bs mouse model is available from Jackson Laboratory on defined genetic background

  • Critical controls:

    • Rescue experiments: Reintroduce wild-type TBC1D20 to confirm phenotype specificity

    • Domain mutants: Use catalytically inactive mutants (e.g., RAB-GAP domain mutants) to distinguish enzymatic from scaffolding functions

    • Off-target validation: Include non-targeting siRNA controls for knockdown experiments

    • Phenotypic comparison: Compare observed phenotypes with published bs mouse data

  • Phenotypic analysis:

    • Cellular assays: Assess Golgi morphology, ER stress markers, and trafficking defects

    • Tissue-specific readouts: For reproductive studies, examine uterine size, gland numbers, myometrial thickness, and decidualization capacity

    • Molecular markers: Measure expression of tissue-specific genes (e.g., Bmp2, Bmp4, Hoxa10, Pgr, Wnt4 for decidualization)

    • Functional tests: For fertility studies, implement embryo implantation and artificial decidualization models

By carefully considering these aspects, researchers can design robust experiments that reliably assess TBC1D20's function while minimizing confounding variables and misinterpretation of results.

What are the most promising future directions for TBC1D20 research?

Based on current findings, several promising research directions emerge for further investigation of TBC1D20's functions and applications:

These directions build upon the established roles of TBC1D20 in membrane trafficking, reproduction, and viral infection, expanding into applications that could translate basic research findings into clinical relevance. The availability of recombinant bovine TBC1D20 and established mouse models provides the necessary tools to pursue these promising research avenues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.