Recombinant Bovine Tetraspanin-12 (TSPAN12)

Shipped with Ice Packs
In Stock

Description

Table 1: Key Biochemical Properties

PropertyDetails
UniProt IDQ29RH7
Expression SystemMammalian cells (HEK293T)
Amino Acid SequenceResidues 1–305 (full-length)
Molecular Weight~30–35 kDa (predicted)
TagsMonomeric Venus (mVenus), 12xHis, Avi-tag (for biotinylation)
StorageTris-based buffer with 50% glycerol; stable at -20°C or -80°C

Functional Roles and Mechanisms

TSPAN12 regulates cell-surface receptor signaling by interacting with ligands such as Norrin (NDP) and modulating pathways like β-catenin and p53 . In bovine studies, recombinant TSPAN12 has been implicated in:

  • Retinal Vascularization: Facilitates Norrin-induced FZD4 receptor multimerization, activating Wnt-independent β-catenin signaling .

  • Cancer Pathways: Modulates ADAM10 and MMP14 metalloproteases, influencing tumor growth and metastasis (observed in human NSCLC models) .

  • Apoptosis Regulation: Silencing TSPAN12 upregulates p53 and downstream effectors (p21, p27), reducing cancer cell proliferation .

Research Applications

Recombinant bovine TSPAN12 is widely used in:

  • Protein Interaction Studies: Capturing Norrin via its LEL domain for structural or functional assays .

  • Antibody Development: Serves as an antigen for generating polyclonal antibodies (e.g., Rabbit Anti-TSPAN12) .

  • Therapeutic Targeting: Explored in cancer (e.g., NSCLC) and retinal disorders like familial exudative vitreoretinopathy (FEVR) .

Table 2: Experimental Use Cases

ApplicationMethod/ModelKey Findings
Norrin Binding AssaysBiolayer Interferometry (BLI)Affinity: 10.4 ± 1.2 nM (TSPAN12-Norrin)
Cancer StudiesNSCLC xenograft modelsTSPAN12 silencing reduces tumor volume by 60%
Signal TransductionSTF cell luciferase assaysMutant TSPAN12 fails to activate β-catenin

Production Challenges and Solutions

Producing functional recombinant TSPAN12 is technically demanding due to:

  • Membrane Protein Instability: Requires lipid nanodiscs or detergent micelles for solubility .

  • Low Yield: Optimized constructs (e.g., residues 116–220 for LEL) improve expression to ~0.1 mg/L .

  • Post-Translational Modifications: Mammalian systems (HEK293T) preserve disulfide bonds and glycosylation .

Future Directions

  • Structural Studies: Cryo-EM of TSPAN12-FZD4-Norrin complexes to guide drug design .

  • Species-Specific Roles: Comparative analyses of bovine vs. human TSPAN12 in retinal and cancer biology .

  • Clinical Translation: Develop TSPAN12 inhibitors for NSCLC or FEVR, leveraging its inverse correlation with p53 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate special requirements for the format. Please specify your preferred format in the order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments include standard blue ice packs. If dry ice is required, please inform us in advance. An additional fee may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSPAN12; Tetraspanin-12; Tspan-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TSPAN12
Target Protein Sequence
MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNNVLTLTAETRVEEAVILTYF PVVHPVMIAVCCFLIIVGMLGYCGTVKRNLLLLAWYFGSLLVIFCVELACGVWTYEQEIM VPVQWSDMVTLKARMTNYGLPRYRWLTHAWNFFQREFKCCGVVYFTDWLEMTEMDWPPDS CCVREFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQILAMIL TITLLWALYYDRREPGTDQMMALKNDTTQHLPCHSVELLKPSLSRIFEHTSMANSFNTHF EMEEL
Uniprot No.

Target Background

Function
Tetraspanin-12 (TSPAN12) is a regulator of cell surface receptor signal transduction. It plays a crucial role in retinal vascularization by regulating norrin (NDP) signal transduction. TSPAN12 works in conjunction with norrin (NDP) to promote FZD4 multimerization and subsequent activation of FZD4, leading to an increase in beta-catenin (CTNNB1) accumulation and stimulating LEF/TCF-mediated transcriptional programs. Interestingly, TSPAN12 only activates the norrin (NDP)-dependent activation of FZD4, but not the Wnt-dependent activation, suggesting the existence of a Wnt-independent signaling pathway that also promotes beta-catenin (CTNNB1) accumulation. TSPAN12 acts as a regulator of membrane proteinases such as ADAM10 and MMP14/MT1-MMP. It activates ADAM10-dependent cleavage activity of amyloid precursor protein (APP). Additionally, it activates MMP14/MT1-MMP-dependent cleavage activity.
Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the known cellular functions of TSPAN12?

TSPAN12 serves multiple functions in different cellular contexts:

  • In vascular development, TSPAN12 functions as a co-receptor for Norrin, promoting β-catenin signaling through interaction with Frizzled-4 (Fzd4) .

  • In cancer biology, particularly in NSCLC, TSPAN12 acts as a tumor promoter by modulating p53 pathway activity, affecting cell proliferation and apoptosis .

  • In endocrine systems, TSPAN12 serves as a negative regulator of aldosterone production, with expression levels inversely correlated with plasma aldosterone concentrations .

  • In neurovascular development, TSPAN12 plays a critical role in central nervous system blood vessel formation and blood-brain/retina barrier establishment .

How does TSPAN12 interact with other proteins in signaling pathways?

TSPAN12 primarily mediates its functions through protein-protein interactions:

  • In Norrin-Fzd4 signaling, TSPAN12 directly captures Norrin through its LEL domain, enhancing Norrin binding to Fzd4 receptors. This interaction shows negative cooperativity, suggesting that TSPAN12 captures Norrin and then hands it off to nearby Fzd4 for signaling .

  • In NSCLC cells, TSPAN12 inversely correlates with p53 expression and affects downstream targets like p21 and p27, suggesting a regulatory role in the p53 pathway .

  • In adrenal cells, TSPAN12 expression is regulated by angiotensin II through calcium-dependent mechanisms, as evidenced by the ablation of angiotensin II-induced TSPAN12 expression by calcium channel blockers like nifedipine or calmodulin antagonists like W-7 .

What are the technical challenges in producing recombinant TSPAN12 and how can they be overcome?

Producing recombinant TSPAN12, particularly the EC2 domain, presents significant technical challenges. Previous studies have noted difficulties in obtaining adequate yields of purified Tspan12EC2 . To address these challenges:

  • Optimization of expression constructs is critical. Variations in the location of the Tspan12EC2 N- and C-termini produce large effects on protein yield. For instance, construct optimization studies have shown that specific fragments (such as Tspan12 residues 116-220) may exhibit higher yields than others .

  • Expression system selection is important. Both insect cell systems (Sf9) and mammalian expression systems (Expi293) have been used for TSPAN12 production with different protocols:

    • For Sf9 cells: Infection at 3×10^6 cells/mL with 1:300 vol/vol virus and harvest after 48 hours

    • For Expi293 cells: Transfection with PEIpro, enhancement with 10 mM sodium butyrate after 16 hours, and harvest 48 hours post-transfection

  • Membrane protein extraction protocols involving nitrogen cavitation at 650 psi for 30 min in appropriate buffers, followed by differential centrifugation steps and membrane resuspension in high-salt and low-salt buffers, have proven effective .

How can researchers effectively investigate TSPAN12's role in tumor progression?

Given TSPAN12's tumor-promoting role in NSCLC, researchers investigating its function in cancer should consider:

  • Expression analysis in clinical samples: Compare TSPAN12 mRNA and protein levels between tumor samples and adjacent normal tissues. Studies have shown significantly increased TSPAN12 expression in NSCLC samples compared to paracancerous histologic normal tissues .

  • Correlation analysis with tumor suppressors: Investigate the relationship between TSPAN12 and p53, as they show inverse correlation in NSCLC specimens .

  • Functional studies using gene silencing: Use short hairpin RNA (shRNA) to knockdown TSPAN12 and assess effects on:

    • Cell proliferation (typically inhibited with TSPAN12 knockdown)

    • Colony formation (reduced with TSPAN12 silencing)

    • Apoptosis (increased with TSPAN12 knockdown)

  • Mechanistic studies: Examine the effects of TSPAN12 modulation on:

    • p53 pathway components (p21, p27)

    • Apoptotic markers

    • Cell cycle regulators

  • In vivo tumor models: Establish xenograft models with TSPAN12-silenced cells to assess tumor growth characteristics in animal models .

What methods can be used to study TSPAN12's interaction with Norrin in the context of vascular development?

For researchers investigating TSPAN12's role as a Norrin co-receptor:

  • Binding assays using:

    • Purified receptors incorporated into nanodiscs

    • Cell-based binding assays with Fzd4-expressing cells

    • Studies comparing binding at varying Norrin concentrations (effects are most evident at very low Norrin concentrations)

  • Mutagenesis approaches:

    • Structure-guided mutagenesis based on AlphaFold predictions

    • Validation of binding interfaces through mutation of key residues at proposed interaction sites

  • Cooperative binding analysis:

    • Examination of how TSPAN12 and Fzd4 cooperatively or competitively bind Norrin

    • Assessment of the negative cooperativity between Fzd4 CRDL and TSPAN12 in Norrin binding

How can researchers investigate TSPAN12's role in regulating aldosterone production?

To study TSPAN12's function as a negative regulator of aldosterone production:

  • Transcriptome analysis: Perform gene ontology analysis of specimens (e.g., aldosterone-producing adenomas) dichotomized by high versus low TSPAN12 expression to identify associated pathways .

  • Correlation studies: Assess the relationship between TSPAN12 expression levels and clinical parameters like plasma aldosterone concentrations .

  • In vivo models: Use animal models (such as pigs under dietary sodium modulation) to study TSPAN12 expression in response to renin-angiotensin system activation. Techniques include:

    • mRNA quantification

    • Immunostaining of adrenal cortex zones (particularly zona glomerulosa)

  • In vitro stimulation studies: Examine TSPAN12 expression in adrenocortical cells (like HAC15) under various conditions:

    • Angiotensin II stimulation (10 nM for 6 hours typically increases TSPAN12 expression 1.6-fold)

    • Calcium channel blocker treatment (10 μM nifedipine)

    • Calmodulin antagonist application (30 μM W-7)

  • Functional studies: Perform gene silencing of TSPAN12 in adrenocortical cells to assess impacts on aldosterone secretion under both basal and stimulated conditions .

What expression systems are optimal for recombinant TSPAN12 production?

Based on the available research, several expression systems have been employed for TSPAN12 production:

Expression SystemAdvantagesChallengesOptimization Strategies
Sf9 Insect CellsGood for membrane proteins, Post-translational modificationsLower yields for some constructsInfection at 3×10^6 cells/mL, 1:300 vol/vol virus, 48hr harvest
Expi293 Mammalian CellsMammalian post-translational modifications, Higher yields for some constructsHigher cost, More complex culturePEIpro transfection, 10 mM sodium butyrate enhancement, 48hr harvest

When selecting an expression system, researchers should consider:

  • The specific domain of TSPAN12 being expressed (full-length vs. EC2 only)

  • The requirement for post-translational modifications

  • The intended application (structural studies, binding assays, etc.)

  • The scale of production needed

What purification strategies work best for recombinant TSPAN12?

For efficient purification of TSPAN12:

  • Membrane protein extraction:

    • Nitrogen cavitation at 650 psi for 30 min in appropriate buffers (20 mM HEPES pH 8.0, 65 mM NaCl for Sf9 or 10 mM NaCl for Expi293, 1 mM EDTA, 10 mM iodoacetamide)

    • Differential centrifugation (1000 × g for 15 min followed by 200,000 × g for 40 min)

    • Membrane resuspension in high-salt buffer (50 mM HEPES pH 8, 300 mM NaCl) followed by low-salt buffer (50 mM HEPES pH 8, 100 mM NaCl)

  • Affinity purification:

    • For His-tagged constructs, immobilized metal affinity chromatography (IMAC) has proven effective

    • For difficult-to-express constructs, fusion to fluorescent proteins like mVenus allows for efficient detection through in-gel fluorescent imaging

  • Quality assessment:

    • Size-exclusion chromatography to ensure protein homogeneity

    • Functional binding assays to confirm proper folding and activity

How can researchers effectively assess TSPAN12's functional interactions with binding partners?

To characterize TSPAN12's interactions with partners like Norrin or components of the p53 pathway:

  • In vitro binding assays:

    • Purified proteins in solution-phase binding studies

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Nanodiscs to mimic the membrane environment for more physiologically relevant studies

  • Cellular assays:

    • Co-immunoprecipitation to detect protein-protein interactions

    • Immunofluorescence analysis to assess co-localization

    • FRET-based approaches to detect close proximity in living cells

  • Functional readouts:

    • Signaling pathway activation (e.g., β-catenin pathway)

    • Cellular responses (proliferation, apoptosis)

    • Gene expression changes of downstream targets

  • Structure-guided mutagenesis:

    • Computational modeling (e.g., AlphaFold) to predict interaction interfaces

    • Systematic mutation of key residues to validate binding sites

    • Functional analysis of mutants to correlate structure with function

How does TSPAN12 research contribute to understanding cancer biology?

TSPAN12 research offers significant insights into cancer biology, particularly for NSCLC:

  • As a biomarker: TSPAN12 overexpression in NSCLC samples compared to normal tissues suggests its potential as a diagnostic or prognostic marker .

  • Mechanistic insights: TSPAN12's inverse correlation with p53 and its ability to modulate p21 and p27 expression reveals novel mechanisms of tumor promotion through interference with key tumor suppressor pathways .

  • Therapeutic target: The inhibition of cell growth and increased apoptosis observed with TSPAN12 silencing indicates its potential as a therapeutic target. In xenograft models, TSPAN12 silencing significantly inhibits tumor growth of H1299 cells, suggesting efficacy for in vivo applications .

What is the relevance of TSPAN12 in vascular development disorders?

TSPAN12 research has direct implications for vascular development disorders:

  • Familial exudative vitreoretinopathy (FEVR): TSPAN12 deficiency results in this hereditary disorder characterized by abnormal development of retinal vasculature .

  • Norrin signaling pathway: TSPAN12 serves as a co-receptor for Norrin, enhancing Norrin-Fzd4 signaling, which is crucial for proper vascular development. Understanding this molecular mechanism provides insights into developmental vascular disorders .

  • Blood-brain/retina barrier formation: TSPAN12's role in establishing these barriers has implications for disorders affecting vascular integrity in the central nervous system and eye .

How can TSPAN12 research inform understanding of hypertension and endocrine disorders?

TSPAN12's function as a negative regulator of aldosterone production has important implications for:

  • Primary aldosteronism: The inverse correlation between TSPAN12 expression and aldosterone production suggests that decreased TSPAN12 could contribute to aldosterone overproduction in primary aldosteronism, a common cause of endocrine hypertension .

  • Renin-angiotensin system regulation: TSPAN12 expression increases in response to angiotensin II and dietary salt restriction, indicating its involvement in physiological adaptations to renin-angiotensin system activation .

  • Therapeutic strategies: Understanding TSPAN12's role in aldosterone regulation could inform the development of novel therapeutic approaches for hypertension, particularly in cases resistant to conventional treatments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.