Recombinant Bovine Tetraspanin-13 (TSPAN13)

Shipped with Ice Packs
In Stock

Description

Introduction to Tetraspanin-13

Tetraspanin-13 belongs to the transmembrane 4 superfamily, also known as tetraspanins. These proteins are characterized by their specific structural features, including four transmembrane domains with conserved polar residues, a large extracellular loop containing multiple conserved cysteine residues, a small extracellular loop, and short cytoplasmic tails . Tetraspanins function as organizers of molecular complexes on cell membranes and are widely expressed on the surface of most nucleated cells . They participate in numerous physiological processes including cell development, activation, growth, and motility through mediating signal transduction events .

In humans, the TSPAN13 gene encodes a 204-amino acid protein with a predicted molecular weight of approximately 22 kDa, and this protein structure is highly conserved across species, including in bovines . TSPAN13 has been identified in multiple species including human, mouse, rat, bovine, and chicken, indicating its evolutionary significance .

Post-translational Modifications

Like other tetraspanins, bovine TSPAN13 undergoes post-translational modifications, particularly glycosylation of its extracellular domains . Additionally, intracellular cysteines are often modified by palmitoylation, which is crucial for the protein's membrane association and interaction with other proteins within the tetraspanin-enriched microdomains (TEMs) .

Expression Systems

Recombinant bovine TSPAN13 protein is typically produced using bacterial expression systems, with Escherichia coli being the most common host . The expression construct typically includes the full-length bovine TSPAN13 gene (coding for amino acids 1-204) with an N-terminal histidine tag to facilitate purification .

Purification Methods

The recombinant protein is usually purified using immobilized metal affinity chromatography (IMAC), taking advantage of the histidine tag's affinity for metal ions . After purification, the protein typically achieves greater than 90% purity as determined by SDS-PAGE analysis .

Membrane Organization

Tetraspanins, including TSPAN13, are known for their ability to organize membrane proteins into functional clusters known as tetraspanin-enriched microdomains (TEMs) . These microdomains serve as platforms for various cellular processes, including signal transduction, cell adhesion, and membrane fusion .

Regulation of Ion Channels

A significant function of TSPAN13 is the modulation of voltage-gated calcium channels. Research has identified TSPAN13 as an interaction partner of the α1 subunit of N-type CaV2.2 calcium channels, but not of P/Q-type CaV2.1 or L- and T-type calcium channels . This interaction occurs between domain IV of CaV2.2 and transmembrane segments S1 and S2 of TSPAN13 .

Electrophysiological analysis has revealed that TSPAN13 specifically modulates the efficiency of coupling between voltage sensor activation and pore opening of the channel . It accelerates the voltage-dependent activation and inactivation of the Ba2+ current through CaV2.2, suggesting that TSPAN13 might regulate calcium channel activity in defined synaptic membrane compartments and thereby influence neurotransmitter release .

Protein-Protein Interactions

TSPAN13 engages in numerous protein-protein interactions, forming complexes with other tetraspanins and various transmembrane and cytosolic proteins . Recent research has shown that tetraspanins, including TSPAN13, can form heterogeneous complexes with other members of the tetraspanin family .

In one study, TSPAN13 was found to associate with endothelin converting enzyme (ECE1), specifically recruiting it to tetraspanin-enriched microdomains and positively modulating its enzymatic activity . This interaction suggests a role for TSPAN13 in the regulation of the endothelin system, which is involved in various physiological processes including vasoconstriction and cell proliferation .

Expression in Bovine Ovarian Tissue

Research has identified the presence of various tetraspanins, including TSPAN13, in bovine ovarian tissue . The distribution of tetraspanins at different stages of follicular development in cattle has been studied, revealing potential roles in folliculogenesis and oogenesis .

The localization patterns of tetraspanins like CD9, CD63, and integrin alpha V in similar areas of bovine ovarian tissue suggests potential cooperative functions . While the specific role of TSPAN13 in bovine reproductive physiology is still being elucidated, its presence in ovarian tissue indicates a potential involvement in reproductive processes .

Research Tool

Recombinant bovine TSPAN13 serves as a valuable research tool for studying protein-protein interactions, particularly in the context of membrane biology . It can be used in various applications including:

  • Antibody production and validation

  • Protein-protein interaction studies

  • Structure-function analyses

  • Comparative studies across species

Relevance to Veterinary Medicine

Understanding the functions of TSPAN13 in bovine tissues has potential implications for veterinary medicine, particularly in areas related to:

  • Reproductive physiology and fertility

  • Neurological function, given TSPAN13's role in modulating calcium channels

  • Immune system regulation, as tetraspanins often play roles in immune cell function

Model for Human Studies

Bovine TSPAN13 shares significant homology with human TSPAN13, making it a useful model for understanding the human protein's functions . Research on bovine TSPAN13 can provide insights that may be translatable to human health and disease, particularly in conditions where TSPAN13 dysregulation has been implicated, such as certain cancers .

Reconstitution Protocol

For reconstitution of lyophilized recombinant bovine TSPAN13:

  1. Briefly centrifuge the vial to bring contents to the bottom

  2. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add 5-50% glycerol (final concentration) for long-term storage

  4. Aliquot and store at -20°C/-80°C

Stability Considerations

Repeated freezing and thawing is not recommended as it can lead to protein degradation and loss of activity . For optimal results, the recombinant protein should be used promptly after reconstitution or properly stored in aliquots to minimize freeze-thaw cycles.

Functional Studies in Bovine Tissues

Further studies investigating the specific functions of TSPAN13 in various bovine tissues would enhance our understanding of its physiological roles. Particular attention could be given to:

  • Reproductive tissues, given the identified presence in ovarian tissue

  • Nervous system, considering its role in calcium channel modulation

  • Immune system, as tetraspanins often have immunoregulatory functions

Comparative Analysis

Comparative studies between bovine TSPAN13 and its counterparts in other species would provide evolutionary insights and help identify conserved functional domains. Such research could contribute to a better understanding of tetraspanin biology across species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSPAN13; Tetraspanin-13; Tspan-13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TSPAN13
Target Protein Sequence
MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIA LVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQAQLLEVGWNNTASARD DIQRNLNCCGFRSFNPNDTCLASCVKSSHPCSPCAPIIGRYAGEVLRFVGGIGLFFSFTE ILGVWLTYRYRNQKDPRANPSAFL
Uniprot No.

Target Background

Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.