Recombinant Bovine Tetraspanin-17 (TSPAN17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please specify them in your order remarks. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing it accordingly.
Synonyms
TSPAN17; Tetraspanin-17; Tspan-17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TSPAN17
Target Protein Sequence
MPGKHQHFQEPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWSEKGVLSNISALTDLGG LDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDW IRDQLNLFINNNVKAYRDDIDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRE RCGVPFSCCVRDPAEDVLNTQCGYDVRLKLELEQQGFIHTKGCVGQFEKWLQDNLIVVAG VFVGIALLQIFGICLAQNLVSDIKAVKANW
Uniprot No.

Target Background

Function
Regulates ADAM10 maturation.
Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tetraspanin-17 (TSPAN17) and what are its main cellular functions?

TSPAN17 is a member of the tetraspanin family, characterized by four transmembrane domains with two extracellular loops. It belongs to the TspanC8 subgroup that interacts with the transmembrane metalloprotease ADAM10. This interaction is crucial for ADAM10's exit from the endoplasmic reticulum, enzymatic maturation, and transport to the cell surface . The TSPAN17/ADAM10 complex influences ADAM10's substrate specificity, determining which molecules ADAM10 will cleave .

In endothelial cells, TSPAN17 regulates VE-cadherin expression, contributing to leukocyte transmigration across the blood vessel lining . Like other tetraspanins, TSPAN17 likely participates in cellular processes including adhesion, migration, and fusion, as the extracellular domain (EC2) of tetraspanins has been shown to modulate these events when added to cells exogenously .

How does the structure of TSPAN17 contribute to its functional properties?

TSPAN17, like other tetraspanins, contains four transmembrane domains with two extracellular loops - a small extracellular loop (EC1) and a large extracellular loop (EC2). The EC2 domain is thought to attribute specificity to individual tetraspanin members and is critical for protein-protein interactions .

The EC2 domain likely contains specific epitopes that determine TSPAN17's interactions with partners like ADAM10. Studies on other tetraspanins suggest that the large extracellular loop (LEL) contains highly conserved cysteine sequences that form disulfide bonds essential for proper folding and function . These structural features allow tetraspanins to form specialized membrane microdomains and mediate specific protein interactions that influence various cellular processes.

What expression systems are optimal for producing functional recombinant bovine TSPAN17?

Based on research with other tetraspanins, expressing recombinant TSPAN17 presents significant challenges. Previous attempts to express tetraspanin EC2 domains in mammalian or insect cells using different vector systems were unsuccessful despite evidence of DNA integration into the host genome and mRNA expression .

Bacterial expression systems have been used as an alternative for producing recombinant tetraspanin EC2 domains, though they come with inherent drawbacks including LPS contamination and potentially inferior folding compared to eukaryotic expression systems . For optimal expression of recombinant bovine TSPAN17, researchers might need to:

  • Test multiple expression systems (bacterial, yeast, insect, and mammalian)

  • Optimize codon usage for the chosen expression system

  • Include appropriate fusion tags (GST, His-tag) to improve solubility and purification

  • Consider expressing only the EC2 domain rather than the full-length protein

  • Use specialized expression hosts designed for membrane proteins

What purification strategies yield the highest purity and biological activity for recombinant TSPAN17?

While specific purification strategies for bovine TSPAN17 are not directly addressed in the literature, effective purification of recombinant tetraspanins typically involves:

  • Affinity chromatography using fusion tags (GST, His-tag) as an initial capture step

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Ion exchange chromatography for further purification

  • For full-length TSPAN17, careful selection of detergents for solubilization is critical

  • Quality control assessment using techniques such as circular dichroism to ensure proper folding

For EC2 domains expressed as GST fusion proteins (as has been done with other tetraspanins), affinity purification using glutathione resin followed by tag removal and additional chromatography steps has proven effective . Special attention must be paid to maintaining the native disulfide bonding pattern in the EC2 domain, which is essential for biological activity.

How can researchers assess the functionality of recombinant bovine TSPAN17 in vitro?

Functional assessment of recombinant bovine TSPAN17 can be approached through several complementary methods:

  • Binding assays with known interaction partners, particularly ADAM10

  • Cell-based assays measuring effects on:

    • Cell adhesion, migration, and invasion

    • VE-cadherin expression in endothelial cells

    • Leukocyte transmigration across endothelial monolayers

  • Competition assays with endogenous TSPAN17

  • Assessment of effects on ADAM10 substrate cleavage specificity

  • Structural integrity assessment using techniques like circular dichroism

One approach demonstrated with other tetraspanins involved using recombinant EC2 domains in conjunction with RBL-2H3 cells (a mast cell model) to examine tetraspanin involvement in IgE-mediated degranulation . Similar cell-based functional assays could be adapted for bovine TSPAN17.

What molecular techniques are most effective for studying TSPAN17 interactions with partner proteins?

To effectively study TSPAN17's interactions with partner proteins such as ADAM10, several techniques can be employed:

  • Co-immunoprecipitation using specific antibodies against TSPAN17 or its partners

  • FRET/BRET assays for real-time interaction analysis in living cells

  • Surface plasmon resonance to determine binding kinetics with purified proteins

  • Proximity ligation assays for visualizing protein interactions in situ

  • Yeast two-hybrid or mammalian two-hybrid screens to identify novel interaction partners

  • Mass spectrometry-based interactome analysis following crosslinking

  • Biolayer interferometry for label-free interaction analysis

For studying the TSPAN17-ADAM10 interaction specifically, measuring ADAM10 enzymatic activity in the presence of recombinant TSPAN17 would provide functional validation. Additionally, examining how TSPAN17 affects ADAM10's substrate specificity could reveal important aspects of this interaction's biological significance .

How is TSPAN17 involved in cancer progression and what research methods can elucidate its role?

Research indicates that TSPAN17 may play a significant role in cancer progression, particularly in glioblastoma multiforme (GBM). High TSPAN17 expression levels are associated with poor survival in GBM patients, while miR-378a-3p, which targets TSPAN17, inhibits cellular proliferation and migration in GBM cells .

To investigate TSPAN17's role in cancer, researchers can:

  • Perform expression analyses in tumor vs. normal tissues using qRT-PCR and western blotting

  • Use siRNA/shRNA or CRISPR-Cas9 to knock down/out TSPAN17 in cancer cell lines

  • Overexpress TSPAN17 in appropriate cell models

  • Assess the effects of recombinant TSPAN17 on cancer cell behaviors (proliferation, migration, invasion)

  • Investigate the relationship between TSPAN17 and regulatory microRNAs like miR-378a-3p

  • Develop animal models with modified TSPAN17 expression to study tumor growth and metastasis in vivo

These approaches can help elucidate whether TSPAN17 represents a viable therapeutic target for cancer treatment.

What is known about TSPAN17's role in metabolic and cardiovascular disorders?

TSPAN17 has been associated with several metabolic and cardiovascular disorders, including:

  • Hypertriglyceridemia 2

  • Cholesterol-ester transfer protein deficiency

  • Homozygous familial hypercholesterolemia

  • Hypercholesterolemia, autosomal dominant, 3

  • Pancreatic triacylglycerol lipase deficiency

  • Hyperlipidemia due to hepatic triglyceride lipase deficiency

  • Sitosterolemia

While these associations have been documented, the specific mechanisms by which TSPAN17 contributes to these disorders are not well understood. Research methodologies to investigate these connections could include:

  • Genetic association studies in patient populations

  • Functional studies in models of lipid metabolism

  • Investigation of TSPAN17's influence on lipid transporters and metabolic enzymes

  • Analysis of TSPAN17's role in regulating VE-cadherin and endothelial barrier function

  • Assessment of how TSPAN17-ADAM10 interactions might influence lipid metabolism

Understanding these mechanisms could potentially identify TSPAN17 as a therapeutic target for metabolic disorders.

How can recombinant TSPAN17 be used as a tool for developing novel therapeutics?

Recombinant TSPAN17 provides several avenues for therapeutic development:

  • As a competitive inhibitor of endogenous TSPAN17-partner interactions

  • As an antigen for developing function-blocking antibodies

  • As a screening tool for identifying small molecule modulators of TSPAN17 function

  • For structure-based drug design targeting the TSPAN17-ADAM10 interaction

  • As a model for studying tetraspanin functions that could be targeted therapeutically

The development of recombinant Eg-TSP11 (a tetraspanin from E. granulosus) provides precedent for tetraspanin-based therapeutics. Vaccination with rEg-TSP11 significantly decreased worm burden and inhibited segment development in a dog model of E. granulosus infection, with a 76.80% reduction in worm number compared to controls . This demonstrates that recombinant tetraspanins can elicit protective immune responses that might be leveraged for therapeutic purposes.

How do post-translational modifications affect TSPAN17 function and how can they be studied?

Post-translational modifications likely play important roles in regulating TSPAN17 function. While specific information about TSPAN17 modifications is limited, studies on related tetraspanins provide insight. For example, tetraspanin TSP11 has five protein kinase phosphorylation sites and one tyrosine kinase phosphorylation site that are thought to be critical for its function .

To study post-translational modifications of TSPAN17, researchers can:

  • Perform mass spectrometry-based proteomics to identify types and sites of modifications

  • Create site-directed mutants to assess the functional importance of specific modification sites

  • Use modification-specific antibodies for western blotting and immunofluorescence

  • Employ phosphatase or glycosidase treatments to assess the effects of removing modifications

  • Conduct metabolic labeling experiments to track modification dynamics

  • Investigate kinases or other enzymes responsible for TSPAN17 modifications

Understanding these modifications could reveal important regulatory mechanisms and potential therapeutic intervention points.

What techniques can be used to study TSPAN17's role in tetraspanin-enriched microdomains (TEMs)?

Tetraspanins form specialized membrane microdomains that function as platforms for protein interactions and signaling. To study TSPAN17's role in TEMs, researchers can employ:

  • Detergent resistance assays to isolate TEM-associated proteins

  • Super-resolution microscopy (STORM, PALM) to visualize TEMs with nanometer precision

  • Proximity-dependent biotinylation (BioID, TurboID) to identify proteins in close proximity to TSPAN17

  • FRET-based approaches to measure protein-protein interactions within TEMs

  • Lipidomics to characterize the lipid composition of TSPAN17-containing microdomains

  • Single-particle tracking to analyze TSPAN17 dynamics in the membrane

These techniques can help elucidate how TSPAN17 organizes and regulates TEMs and how these microdomains contribute to cellular functions like leukocyte transmigration.

How can CRISPR-Cas9 genome editing be leveraged to advance TSPAN17 research?

CRISPR-Cas9 technology offers powerful approaches for studying TSPAN17 function. BioGRID ORCS database indicates that TSPAN17 has been identified as a hit in 21 out of 1368 CRISPR screens, suggesting its involvement in multiple cellular processes .

Researchers can use CRISPR-Cas9 to:

  • Generate knockout cell lines to study loss-of-function phenotypes

  • Create knock-in models with fluorescent or affinity tags for tracking TSPAN17 localization and interactions

  • Perform genome-wide CRISPR screens to identify genetic interactions with TSPAN17

  • Engineer precise mutations to study structure-function relationships

  • Develop animal models with modified TSPAN17 for in vivo studies

  • Employ CRISPRa/CRISPRi systems to modulate TSPAN17 expression levels without altering the genome

Analysis of existing CRISPR screen data from repositories like BioGRID ORCS can also provide insights into cellular processes and pathways involving TSPAN17 .

What comparative approaches can be used to study species-specific differences in TSPAN17 function?

Comparing bovine TSPAN17 with its human and other mammalian counterparts can provide valuable insights into conserved and species-specific functions. Researchers can employ:

  • Sequence alignment and phylogenetic analysis to identify conserved domains and species-specific variations

  • Homology modeling to predict structural differences between bovine and human TSPAN17

  • Cross-species complementation studies using recombinant proteins

  • Comparative expression analysis across tissues in different species

  • Functional assays comparing the effects of bovine vs. human TSPAN17 on processes like ADAM10 activation

  • Analysis of species-specific interaction partners

These comparative approaches can help identify evolutionarily conserved functions that are likely fundamental to TSPAN17 biology, as well as species-specific adaptations that might be relevant to bovine physiology or pathology.

Table 1: Comparison of TSPAN17 with Other Studied Tetraspanins

TetraspaninSpeciesKey Interacting PartnersAssociated FunctionsExpression Systems UsedDisease Associations
TSPAN17HumanADAM10VE-cadherin regulation, leukocyte transmigrationNot specified in available dataGBM, hypercholesterolemia, metabolic disorders
CD9, CD63, CD81, CD151Not specifiedNot specifically detailedIgE mediated degranulationBacterial expression of EC2 domainsInvolved in degranulation pathways
Eg-TSP11E. granulosusNot specifically detailedImmune interactions, parasite survivalProkaryotic expressionE. granulosus infection

Table 2: Experimental Approaches for Studying Recombinant TSPAN17

Research ObjectiveMethodological ApproachTechnical ConsiderationsExpected Outcomes
Expression of rTSPAN17Bacterial, yeast, insect, or mammalian expression systemsMembrane protein expression challenges; proper folding of EC2 domain; fusion tag selectionFunctional protein for biochemical and cellular studies
Purification of rTSPAN17Affinity chromatography, size exclusion, ion exchangeDetergent selection; maintaining disulfide bonds; endotoxin removalHigh-purity protein with preserved structure and function
Functional assessmentBinding assays, cell-based assays, enzyme activity measurementsProtein stability; specific assay development; appropriate controlsValidation of binding partners and biological activities
Structure determinationX-ray crystallography, cryo-EM, NMR spectroscopyMembrane protein crystallization challenges; construct design3D structure revealing functional domains and interaction interfaces
In vivo studiesAnimal models, tissue-specific expressionSpecies differences; delivery methods; dosing regimensPhysiological relevance and therapeutic potential

Table 3: Diseases Associated with TSPAN17 and Research Implications

Disease CategorySpecific ConditionsEvidence for TSPAN17 InvolvementResearch Opportunities
CancerGlioblastoma multiformeHigh TSPAN17 expression associated with poor survival; miR-378a-3p targeting TSPAN17 inhibits proliferation and migration Target for anticancer therapy; biomarker development; understanding migration mechanisms
Metabolic disordersHypertriglyceridemia, familial hypercholesterolemia, cholesterol-ester transfer protein deficiency Genetic association; mechanism unclearInvestigating role in lipid metabolism; target for metabolic disease therapy
Cardiovascular disordersEndothelial dysfunctionRole in regulating VE-cadherin and leukocyte transmigration Understanding vascular inflammation; barrier function regulation
Iron metabolism disordersHemochromatosis type 5, hereditary hyperferritinemia Genetic association; mechanism unclearInvestigating role in iron homeostasis
Thyroid disordersAbnormal thyroid hormone metabolism Genetic association; mechanism unclearUnderstanding role in hormone regulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.