Recombinant Bovine Tetraspanin-33 (TSPAN33)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TSPAN33; Tetraspanin-33; Tspan-33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TSPAN33
Target Protein Sequence
MARRPGAPAAYGEDFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHEEAALACL AVDPAILLIVVGILMFLLTFCGCIGSLRENICLLQTFSLCLTVVFLLQLAAGVLGFVFSD KVRGKVSEIINNAIVHYRDDLDLQNLIDFGQKEFSCCGGISYKDWSLNMYFNCSEDNPSR ERCSVPYSCCLPTPNQAVINTMCGQGMQALDYLEASKVIYTNGCIDRLVNWIHSNLFVLG GVALGLAIPQLVGIMLSMILVSQIKDQIKLQLYNQQHRADPWY
Uniprot No.

Target Background

Function
Recombinant Bovine Tetraspanin-33 (TSPAN33) plays a crucial role in normal erythropoiesis and erythroid progenitor differentiation. It regulates the maturation and trafficking of the transmembrane metalloprotease ADAM10, negatively regulates ligand-induced Notch activity (likely by modulating ADAM10 activity), and mediates ADAM10 docking to zonula adherens through interaction with ADAM10 and, in a PDZD11-dependent manner, with the zonula adherens protein PLEKHA7.
Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, adherens junction. Cytoplasm.

Q&A

What is the basic structure and function of TSPAN33?

TSPAN33 belongs to the tetraspanin family, which are four-transmembrane-spanning proteins that organize membrane microdomains. These proteins play important roles in cellular migration, adhesion, and other processes . Unlike some tetraspanins that associate with ADAM10 trafficking, TSPAN33's specific molecular functions appear distinct, as research shows TSPAN33 expression does not necessarily correlate with ADAM10 surface expression . In B cells, TSPAN33 serves as a marker of activation and is expressed in both early and late stages of B cell development, though notably absent in naive B cells .

How does bovine TSPAN33 differ from human and mouse homologs?

While the search results don't specifically address bovine TSPAN33, comparative studies between human and mouse TSPAN33 have shown conserved expression patterns, particularly in activated B cells. Both mouse and human TSPAN33 are strongly induced following B cell activation . Researchers working with bovine TSPAN33 should note these cross-species similarities while accounting for potential species-specific variations in expression patterns, post-translational modifications, and interaction partners that may influence experimental design and interpretation.

What expression systems are optimal for recombinant bovine TSPAN33 production?

For recombinant TSPAN33 expression, mammalian expression systems are generally preferred due to the protein's multiple transmembrane domains and potential post-translational modifications. Based on methodologies described in the research:

  • HEK293T cells have been successfully used for tetraspanin expression, as demonstrated in TSPAN3, TSPAN15, and other tetraspanin studies

  • Transient transfection using lipid-based reagents such as Lipofectamine 3000 can achieve effective expression

  • Lentiviral transduction systems provide an alternative for stable expression

When expressing bovine TSPAN33 specifically, codon optimization for the expression system and inclusion of appropriate tags (Myc, DDK, or HA) for detection and purification are recommended.

What purification strategies maintain TSPAN33 structural integrity?

Purifying transmembrane proteins like TSPAN33 requires careful consideration of detergent selection and solubilization conditions:

  • Lysis buffer composition: NP-40 (1%) has been successfully used in tetraspanin studies

  • Membrane solubilization: Mild detergents that preserve protein-protein interactions are preferred

  • Affinity purification: Using tag-based approaches (His, FLAG, or MycDDK tags)

  • Buffer conditions: Maintaining physiological pH and ionic strength throughout purification

Researchers should validate the structural integrity of purified TSPAN33 through circular dichroism or other structural analysis methods to ensure the protein retains its native conformation.

How can I verify successful expression and function of recombinant bovine TSPAN33?

Verification approaches should include:

  • Western blot analysis using tag-specific or TSPAN33-specific antibodies

  • Flow cytometry to confirm surface expression in transfected cells

  • Co-immunoprecipitation experiments to verify interaction with known binding partners

  • Functional assays based on known TSPAN33 activities, such as B cell activation markers

For functional verification, comparing wild-type to mutant versions (e.g., transmembrane domain mutations) can help confirm specific activity patterns.

How can recombinant bovine TSPAN33 be used to study B cell activation?

Given TSPAN33's role as a marker of activated B cells , recombinant bovine TSPAN33 can be applied in several experimental approaches:

  • As a positive control in expression studies measuring B cell activation

  • In comparative analyses between resting and activated bovine B cells

  • For developing TSPAN33-targeted antibodies to monitor B cell activation status

  • In mechanistic studies exploring TSPAN33's role in the B cell activation process

Experimental designs should include appropriate stimulation conditions (e.g., LPS, CD40L+IL-4, or anti-IgD+IL-4) that have been shown to upregulate TSPAN33 expression .

What knockdown/knockout strategies are effective for studying TSPAN33 function?

Based on methodologies described in the literature, several approaches have proven effective:

  • siRNA transfection: Using DharmaFECT transfection reagent with 50 nM siRNA concentration

  • shRNA lentiviral transduction: Mission EGFP_shRNA constructs followed by selection with geneticin (300 μg/ml)

  • CRISPR/Cas9 gene editing: Successfully used to generate TSPAN33 knockouts in HEK-293T cells

Validation of knockdown/knockout should be performed at both mRNA level (qRT-PCR) and protein level (Western blot, flow cytometry), with appropriate controls including non-targeting siRNA or shRNA constructs .

How can interaction partners of bovine TSPAN33 be identified?

Several complementary approaches can be used:

  • Yeast two-hybrid screening: Successfully used for other tetraspanins to identify interaction partners

  • Co-immunoprecipitation followed by mass spectrometry: Using tagged recombinant TSPAN33 to pull down interacting proteins

  • Proximity labeling techniques: BioID or APEX2 fusion proteins to identify proteins in close proximity to TSPAN33

  • Single-molecule tracking: To monitor dynamic interactions in living cells, as demonstrated with TSPAN3

When designing co-immunoprecipitation experiments, consider that some tetraspanin interactions may be transient or dependent on specific cellular conditions or stimuli.

What signaling pathways interact with TSPAN33 in B cells?

While the specific signaling pathways for bovine TSPAN33 are not directly addressed in the search results, evidence from human and mouse studies suggests:

  • TSPAN33 is upregulated following stimulation with CD40L+IL-4 or anti-IgD+IL-4, suggesting involvement in these signaling pathways

  • As a tetraspanin, TSPAN33 likely participates in organizing membrane microdomains that facilitate signaling complex formation

  • Based on TSPAN3 research, tetraspanins can act as co-receptors and modulators of signaling pathways

Research approaches should include phosphoproteomic analysis following TSPAN33 knockdown/overexpression and investigation of candidate pathways implicated in B cell activation.

How does TSPAN33 influence membrane organization and receptor trafficking?

Drawing from tetraspanin biology and TSPAN3 research:

  • Tetraspanins organize membrane microdomains by associating with other membrane proteins

  • TSPAN33 may influence receptor mobility in the membrane, similar to how TSPAN3 affects Nogo-A receptor mobility

  • TSPAN33 could potentially be involved in receptor internalization and recycling processes

Experimental approaches to investigate these aspects include single-molecule tracking methodologies, co-localization studies with endosomal markers (EEA1, Lamp-1, Rab11) , and quantitative analysis of receptor surface expression in TSPAN33 knockout/knockdown models.

How is TSPAN33 involved in B cell lymphomas and autoimmune diseases?

Research demonstrates TSPAN33 expression in:

  • Hodgkin's lymphoma and Diffuse large B cell lymphoma (DLBCL)

  • Autoimmune conditions including rheumatoid arthritis (RA) and systemic lupus erythematosus (SLE)

  • Spleen B cells from MRL/Fas(lpr/lpr) mice, a mouse model of SLE

This expression pattern makes TSPAN33 a potential diagnostic biomarker and therapeutic target . Researchers studying bovine lymphomas or autoimmune conditions should investigate whether TSPAN33 shows similar expression patterns and could serve as a disease marker in bovine systems.

What methodologies are effective for studying TSPAN33 in disease models?

Based on the research approaches described:

  • Immunohistochemistry of tissue samples from disease models

  • Flow cytometry analysis of B cells from affected tissues

  • qRT-PCR quantification of TSPAN33 expression in normal versus diseased tissues

  • Therapeutic antibody development targeting TSPAN33-expressing cells

  • Comparative expression analysis across different disease stages

When designing such studies, appropriate controls and validation of bovine-specific reagents are essential for accurate interpretation of results.

What are common challenges in working with recombinant membrane proteins like TSPAN33?

Key challenges include:

  • Low expression levels due to the transmembrane nature of the protein

  • Protein misfolding or aggregation during expression and purification

  • Maintaining native conformation during solubilization and purification

  • Species-specific differences in post-translational modifications

  • Limited availability of bovine-specific antibodies and reagents

Strategies to address these challenges include optimization of expression conditions, careful selection of detergents, and validation of antibody cross-reactivity between species.

How can I troubleshoot low detection levels of recombinant bovine TSPAN33?

If experiencing low detection:

  • Verify transfection efficiency using reporter constructs (e.g., siGLO-red RISC-free siRNA)

  • Optimize lysis conditions to ensure complete solubilization of membrane proteins

  • Enrich membrane fractions before analysis

  • Use signal amplification methods in detection systems

  • Consider alternative tags or tag positions that don't interfere with protein folding

  • Validate primer specificity for bovine TSPAN33 in qRT-PCR applications

What are emerging areas of TSPAN33 research with potential applications?

Based on current knowledge, promising research directions include:

  • Development of TSPAN33-targeted therapeutics for B cell lymphomas and autoimmune diseases

  • Exploration of TSPAN33's role in B cell differentiation and antibody production

  • Investigation of TSPAN33's potential involvement in GPVI cleavage in bovine systems

  • Comparative analysis of TSPAN33 function across species for evolutionary insights

  • Screening for small molecule modulators of TSPAN33 function for research and therapeutic applications

How might systems biology approaches advance TSPAN33 research?

Integrative approaches that could yield valuable insights include:

  • Multi-omics analysis comparing TSPAN33-expressing and non-expressing cells

  • Network analysis to identify TSPAN33-associated signaling hubs

  • Computational modeling of TSPAN33's role in membrane organization

  • Comparative genomics and proteomics across species to identify conserved functional motifs

  • Single-cell transcriptomics to characterize TSPAN33 expression heterogeneity in B cell populations

These approaches could help contextualize TSPAN33's functional role within broader cellular systems and identify novel research avenues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.