Recombinant Bovine Tetraspanin-5 (TSPAN5)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine TSPAN5

Recombinant Bovine Tetraspanin-5 (TSPAN5) is a genetically engineered form of the bovine homolog of the tetraspanin superfamily member TSPAN5, expressed for experimental studies. Tetraspanins are transmembrane proteins characterized by four conserved hydrophobic domains, two extracellular loops, and roles in organizing membrane microdomains (TEMs) that regulate cell adhesion, signaling, and receptor trafficking . Bovine TSPAN5 shares structural and functional conservation with human and rodent orthologs, making it a critical tool for studying conserved biological processes in livestock and comparative models .

Recombinant Production

Recombinant bovine TSPAN5 is typically produced in mammalian expression systems (e.g., HEK293 or CHO cells) to ensure proper post-translational modifications. Key steps include:

  1. Cloning: Bovine TSPAN5 cDNA is inserted into expression vectors.

  2. Transfection: Host cells are transfected to express the protein.

  3. Purification: Affinity chromatography (e.g., anti-TSPAN5 antibodies) isolates the protein .

Role in Membrane Organization

TSPAN5 organizes TEMs that cluster proteins like Neuroligin-1 and GluA2 AMPA receptors, facilitating dendritic spine formation in neurons . In bovine models, this mechanism may underpin synaptic plasticity in the central nervous system.

Receptor Trafficking and Signaling

  • AMPA Receptor Recycling: TSPAN5 interacts with the AP-4 complex to regulate GluA2 subunit recycling via endosomal pathways, a process conserved across species .

  • Notch Pathway Activation: TSPAN5 promotes ADAM10-mediated Notch cleavage, influencing cell differentiation and syncytialization (e.g., in placental trophoblasts) .

Antibody Development

Anti-TSPAN5 antibodies (e.g., RBITC-conjugated polyclonal antibodies) are validated for:

ApplicationDilution RangeReactivity
Western Blot1:300–1:5000Human, Bovine
Immunofluorescence1:50–1:200Mouse, Rat, Cow
Source: Bioss Antibody Specifications

Disease Modeling

  • Cancer Research: TSPAN5 is upregulated in hepatocellular carcinoma (HCC) following DLC1 tumor suppressor loss. Knockdown induces senescence via p16<sup>INK4a</sup>/pRb pathways, suggesting therapeutic potential .

  • Neurodevelopmental Studies: Recombinant bovine TSPAN5 aids in studying synaptic defects linked to AMPA receptor mislocalization .

In Vitro and In Vivo Validation

  • Actin Cytoskeleton Regulation: TSPAN5 depletion reduces F-actin stress fibers and disrupts MKL1-FLNA interactions, impairing SRF-dependent gene expression .

  • Tumor Suppression: In HCC xenografts, TSPAN5 silencing decreases tumor proliferation and invasion, highlighting its role in oncogenesis .

Comparative Insights

  • Evolutionary Conservation: Bovine TSPAN5 shares >90% amino acid identity with human TSPAN5, particularly in EC2 domains critical for TEM assembly .

  • Cross-Species Reactivity: Antibodies against human TSPAN5 (e.g., Proteintech 12122-1-AP) show high specificity for bovine homologs .

Future Directions

Recombinant bovine TSPAN5 is pivotal for:

  1. Agricultural Biotechnology: Enhancing livestock neural health via TSPAN5-mediated synaptic regulation.

  2. Therapeutic Development: Targeting TSPAN5-TEM interactions in cancers or neurodegenerative diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSPAN5; Tetraspanin-5; Tspan-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TSPAN5
Target Protein Sequence
MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGIAFLGIGLWAWNEKGVLSNISSITDLGGFD PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF IGIALLQIFGICLAQNLVSDIEAVRASW
Uniprot No.

Target Background

Function
Regulates ADAM10 maturation and trafficking to the cell surface. Promotes ADAM10-mediated cleavage of CD44.
Database Links

KEGG: bta:538668

UniGene: Bt.97110

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Tetraspanin-5 (TSPAN5) and what are its key structural features?

TSPAN5 belongs to the tetraspanin family of transmembrane proteins conserved across metazoans. The protein presents four transmembrane domains, a small and large extracellular loop, and intracellular N- and C-termini . It forms part of the tetraspanin web, a complex network that organizes membrane proteins into functional units facilitating cell communication and structural organization . TSPAN5 is specifically classified within the C8 subgroup of tetraspanins that interact with the transmembrane metalloprotease ADAM10 . The protein typically appears as a complex pattern of bands on Western blots due to its association with cholesterol-rich membranes, making it poorly soluble in standard lysis buffers .

How does bovine TSPAN5 compare to human TSPAN5 in terms of sequence homology and function?

While the search results don't provide specific information about bovine TSPAN5, tetraspanins are generally highly conserved across mammalian species. Researchers working with bovine TSPAN5 should consider sequence alignment analysis to determine homology with human TSPAN5, which would inform whether findings from human studies might translate to bovine systems. The functional domains, particularly the regions that interact with partners like ADAM10, would be of particular interest for conservation analysis between species .

What cellular compartments typically contain TSPAN5 and how does this distribution change during development?

TSPAN5 exhibits both plasma membrane localization and a substantial intracellular pool, particularly in mature neurons . Research has demonstrated that the ratio between surface and intracellular TSPAN5 shifts during neuronal development. In experiments with rat hippocampal neurons, crosslinking studies showed that the percentage of surface TSPAN5 decreased from approximately 65% at DIV12 (during active synaptogenesis) to around 40% at DIV19 (when neurons are functionally mature) . This shift suggests developmental regulation of TSPAN5 trafficking and potentially different functional roles at different stages of cellular maturation.

What are the known binding partners of TSPAN5 and how are these interactions typically studied?

TSPAN5 interacts with several key proteins as part of its functional role:

  • ADAM10: TSPAN5 is part of the TspanC8 subgroup that interacts with this transmembrane metalloprotease, affecting its exit from the endoplasmic reticulum, enzymatic maturation, trafficking to the cell surface, and substrate specificity .

  • Adaptor Protein Complex AP4: In neurons, TSPAN5 interacts with AP4 as part of the mechanism for AMPA receptor exocytosis .

  • Stargazin: TSPAN5 interacts with this AMPA receptor auxiliary protein in neuronal systems .

  • Neuroligin-1: In previous studies, TSPAN5 was shown to control the surface mobility of this postsynaptic adhesion molecule .

These interactions are typically studied through co-immunoprecipitation assays, proximity ligation assays, and through functional studies where one partner is manipulated and effects on the other are measured .

What are the recommended methods for expressing and purifying recombinant bovine TSPAN5?

Based on approaches used with other tetraspanins, researchers should consider:

  • Expression Systems: Mammalian expression systems (HEK293 or CHO cells) are often preferred for tetraspanins to ensure proper folding and post-translational modifications. E. coli systems may be challenging due to the multiple transmembrane domains.

  • Purification Strategy: A two-step approach is recommended:

    • Affinity chromatography using a tagged construct (His-tag or FLAG-tag)

    • Size exclusion chromatography to separate monomeric protein from aggregates

  • Detergent Selection: Critical for maintaining tetraspanin stability and function. Mild detergents like digitonin, CHAPS, or Brij-series detergents that preserve tetraspanin-enriched microdomains are preferred over harsher detergents like SDS or Triton X-100 .

  • Quality Control: Circular dichroism spectroscopy to confirm proper folding of the purified protein, particularly the correct formation of transmembrane domains.

How can researchers effectively detect and quantify TSPAN5 expression in bovine tissues or cell cultures?

Multiple complementary approaches are recommended:

  • Western Blotting: When analyzing TSPAN5 via Western blot, researchers should be aware that it appears as a complex pattern of bands due to its association with cholesterol-rich membranes, which makes it poorly soluble in standard lysis buffers . Commercial antibodies like ab236881 have been validated for human TSPAN5 , but cross-reactivity with bovine TSPAN5 should be tested or species-specific antibodies developed.

  • Quantitative PCR: Design primers specific to bovine TSPAN5 mRNA for expression analysis. Reference genes appropriate for the tissue being studied should be carefully selected.

  • Immunofluorescence: For cellular localization studies, researchers should consider membrane permeabilization protocols that preserve tetraspanin-enriched microdomains.

  • Surface vs. Intracellular Pools: To distinguish between surface and intracellular TSPAN5, researchers can employ BS3 (bis(sulfosuccinimidyl)suberate) crosslinking, which only crosslinks plasma membrane proteins, creating high molecular weight complexes distinct from the intracellular pool on Western blots .

What knockdown or knockout strategies are most effective for studying TSPAN5 function?

Based on published approaches for TSPAN5:

  • RNA Interference: Short hairpin RNA (shRNA) has been successfully used to knockdown TSPAN5 in neuronal cultures with constructs targeting specific sequences of TSPAN5 . For bovine systems, design of species-specific siRNA or shRNA sequences would be required.

  • CRISPR-Cas9: For complete knockout studies, CRISPR-Cas9 targeting of early exons in the bovine TSPAN5 gene would be most effective. Guide RNA design should consider species-specific sequences.

  • Rescue Experiments: Critical for confirming specificity of knockdown effects. Researchers should design rescue constructs with silent mutations that resist the knockdown but maintain protein function .

  • Inducible Systems: For studying developmental effects, consider doxycycline-inducible or temporal Cre-loxP systems to control the timing of TSPAN5 depletion.

How does TSPAN5 contribute to cancer biology and what are the implications for using bovine TSPAN5 in oncology research models?

TSPAN5 has significant roles in cancer processes, particularly in hepatocellular carcinoma (HCC):

  • Upregulation in Cancer: TSPAN5 is strongly upregulated after loss of the tumor suppressor Deleted in Liver Cancer 1 (DLC1) in both HCC cells and human HCCs .

  • Effects on Tumor Growth: Knockdown of TSPAN5 results in reduced cell proliferation, migration, invasion, and spheroid formation ability in vitro, as well as reduced tumor growth in vivo .

  • Mechanism of Action: TSPAN5 depletion induces oncogene-induced senescence (OIS) as evidenced by:

    • Elevated p16INK4a protein levels

    • Hypophosphorylation of retinoblastoma (Rb)

    • Enhanced phosphorylation of ERK1/2

  • Therapeutic Potential: In xenograft models, siRNAs targeting TSPAN5 complexed in polyethylenimine (PEI) nanoparticles inhibited tumor growth after systemic administration, suggesting TSPAN5 as a potential therapeutic target for DLC1-deficient HCC .

For bovine TSPAN5 research in oncology, investigators should consider comparative studies to determine whether the cancer-promoting mechanisms are conserved across species.

What is the role of TSPAN5 in neuronal function and how might recombinant bovine TSPAN5 be used in neuroscience research?

TSPAN5 plays multiple roles in neuronal function:

  • Dendritic Spine Development: TSPAN5 promotes morphological maturation of dendritic spines during early synaptogenesis by controlling surface mobility of neuroligin-1 .

  • AMPA Receptor Trafficking: In mature neurons, TSPAN5 promotes exocytosis of AMPA receptors without affecting their internalization .

  • Molecular Mechanism: TSPAN5 mediates AMPAR exocytosis by:

    • Interacting with adaptor protein complex AP4

    • Binding to Stargazin (an AMPAR auxiliary protein)

    • Possibly using recycling endosomes as a delivery route

  • Differential Effects on AMPAR Subunits: TSPAN5 knockdown reduces surface GluA2 levels but increases GluA1 levels, potentially altering receptor composition .

For neuroscience research, recombinant bovine TSPAN5 could be valuable for:

  • Comparative studies of neuronal protein trafficking mechanisms

  • Development of tools to manipulate AMPAR trafficking

  • Investigation of species differences in synaptic plasticity mechanisms

How can researchers differentiate between direct and indirect effects of TSPAN5 manipulation in experimental systems?

To establish causality and distinguish direct from indirect effects:

  • Domain Mutation Analysis: Generate recombinant TSPAN5 with mutations in specific domains (large extracellular loop, intracellular tails) to determine which regions mediate specific interactions and functions .

  • Temporal Control: Use rapid induction or inhibition systems (optogenetics, chemical dimerization) to distinguish immediate versus secondary effects of TSPAN5 manipulation.

  • Interaction-Specific Disruption: Design peptides or small molecules that specifically disrupt individual TSPAN5 interactions rather than depleting the entire protein.

  • Rescue Experiments with Defined Mutations: In TSPAN5 knockdown systems, perform rescue experiments with:

    • Wild-type TSPAN5 (should restore normal function)

    • TSPAN5 with mutations in binding sites for specific partners (should rescue only functions independent of that interaction)

  • Proximity Labeling: Use BioID or APEX2 fusion proteins to identify the direct interaction network of TSPAN5 in different cellular compartments.

What are the common difficulties when working with recombinant tetraspanins and how can they be addressed?

Tetraspanins present several technical challenges:

  • Protein Solubility: TSPAN5 associates with cholesterol-rich membranes making it poorly soluble in standard lysis buffers . Solutions include:

    • Use specialized detergent combinations (CHAPS/Brij58)

    • Employ gentler solubilization methods

    • Consider native membrane preparations rather than complete solubilization

  • Western Blot Interpretation: TSPAN5 appears as a complex pattern of bands . Researchers should:

    • Include appropriate positive and negative controls

    • Verify band specificity through knockdown experiments

    • Consider alternative detection methods like mass spectrometry

  • Maintaining Proper Folding: The four transmembrane domains of tetraspanins create folding challenges. Solutions include:

    • Express in mammalian or insect cell systems rather than bacterial systems

    • Optimize purification conditions to maintain native conformation

    • Include cholesterol or other lipids during purification

  • Functional Assays: Because tetraspanins function through protein-protein interactions and organization of membrane microdomains, functional assays can be challenging. Consider:

    • Liposome reconstitution systems

    • Supported lipid bilayers

    • Cell-based assays that preserve membrane integrity

How can researchers address potential species-specific differences when applying findings from human TSPAN5 studies to bovine systems?

To account for species differences:

  • Sequence Alignment Analysis: Perform detailed sequence comparisons focusing on:

    • Transmembrane domains (typically most conserved)

    • Large extracellular loop (typically most variable and involved in specific interactions)

    • Intracellular domains (important for signaling and trafficking)

  • Interaction Verification: Key interactions identified in human systems (ADAM10, AP4, Stargazin) should be verified in bovine systems through:

    • Co-immunoprecipitation with bovine proteins

    • Proximity ligation assays in bovine cells

    • Functional studies in bovine cell models

  • Differential Expression Analysis: Compare tissue-specific expression patterns between human and bovine TSPAN5 to identify potential functional differences.

  • Cross-Species Rescue Experiments: Test whether human TSPAN5 can rescue phenotypes in bovine cells with TSPAN5 knockdown and vice versa.

What data quality control measures should be implemented when analyzing TSPAN5 functional studies?

Robust quality control should include:

  • Antibody Validation: For bovine TSPAN5 studies, antibodies should be validated through:

    • Western blots in TSPAN5 knockdown/knockout systems

    • Immunoprecipitation followed by mass spectrometry

    • Peptide competition assays

    • Testing across multiple bovine tissues/cell types

  • Knockdown Efficiency Verification: When using RNAi approaches:

    • Quantify both mRNA (qPCR) and protein (Western blot) reduction

    • Include scrambled/non-targeting controls

    • Test multiple knockdown constructs to control for off-target effects

  • Statistical Approach:

    • Use appropriate statistical tests based on data distribution

    • Account for technical and biological replicates properly

    • Consider multiple hypothesis testing corrections for large datasets

    • Pre-specify primary outcomes to avoid p-hacking

  • Reproducibility Measures:

    • Test effects across multiple cell lines or primary isolates

    • Replicate key findings using alternative methodologies

    • Validate in vivo findings with multiple experimental models

What emerging technologies might enhance our understanding of TSPAN5 function in different biological contexts?

Several cutting-edge approaches show promise:

  • Cryo-Electron Microscopy: For determining the structure of TSPAN5 alone and in complexes with partners like ADAM10, which would provide insights into the molecular mechanisms of their functional interactions .

  • Super-Resolution Microscopy: Techniques like STORM or PALM could reveal the nanoscale organization of TSPAN5 within tetraspanin-enriched microdomains and track dynamic changes during cellular processes.

  • Organoid Technologies: Development of bovine tissue-specific organoids would provide more physiologically relevant systems to study TSPAN5 function compared to traditional cell culture.

  • Single-Cell Multi-Omics: Combining transcriptomics, proteomics, and epigenomics at single-cell resolution could reveal cell-type specific functions of TSPAN5 in complex tissues.

  • CRISPR Activation/Interference Screens: Genome-wide screens could identify genes that modify TSPAN5-dependent phenotypes, revealing new pathway connections.

How might comparative studies between bovine and human TSPAN5 contribute to translational research?

Comparative approaches offer several advantages:

  • Conservation Analysis: Identifying highly conserved regions between bovine and human TSPAN5 can highlight functionally critical domains that could be therapeutic targets .

  • Species-Specific Interactions: Discovering differences in protein-protein interactions between species could reveal adaptive specializations and context-dependent functions.

  • Disease Modeling: Bovine systems might provide alternative models for human diseases where TSPAN5 plays a role, such as hepatocellular carcinoma or neurological disorders affecting AMPAR trafficking .

  • Agricultural Applications: Understanding TSPAN5 function in bovine systems could have implications for livestock health, particularly in contexts where membrane protein organization and trafficking are critical.

  • Drug Development Pipeline: Bovine TSPAN5 could be used in initial screens for compounds targeting tetraspanin function, with promising candidates then tested against human TSPAN5.

What are the potential therapeutic applications targeting TSPAN5 and how might recombinant bovine TSPAN5 contribute to their development?

Therapeutic approaches targeting TSPAN5 show promise:

  • Cancer Therapeutics: In HCC models, TSPAN5 depletion induced senescence and reduced tumor growth . Potential approaches include:

    • siRNA delivery using polyethylenimine (PEI) nanoparticles, which has shown efficacy in xenograft models

    • Development of monoclonal antibodies targeting the large extracellular loop

    • Small molecule inhibitors of specific TSPAN5 interactions

  • Neurological Applications: Given TSPAN5's role in AMPAR trafficking , modulation could be relevant for:

    • Conditions with glutamate signaling dysfunctions

    • Synaptic plasticity disorders

    • Neurodevelopmental conditions affecting dendritic spine formation

  • Diagnostic Applications: TSPAN5 overexpression in human HCC suggests potential as a diagnostic marker .

  • Combination Approaches: Long-term HCC therapy using a combination of senescence induction by TSPAN5 depletion followed by senolytic therapy has been proposed .

Recombinant bovine TSPAN5 could contribute to these developments by:

  • Serving as a structural template for drug design

  • Providing material for high-throughput screening of compound libraries

  • Supporting development of detection systems for diagnostic applications

  • Enabling comparative testing of therapeutic approaches across species

Comparative Analysis of TSPAN5 Interaction Partners and Functions

Interaction PartnerCellular ContextFunctional OutcomeDetection MethodReference
ADAM10Multiple cell typesRegulates ADAM10 exit from ER, enzymatic maturation, trafficking to cell surface, and substrate specificityVarious biochemical approaches
AP4NeuronsPromotes AMPAR exocytosisCo-immunoprecipitation
StargazinNeuronsFacilitates AMPAR exocytosisCo-immunoprecipitation
Neuroligin-1Developing neuronsControls surface mobility, promotes dendritic spine maturationNot specified in current search results
MKL1HCC cellsAffects target gene expressionGene expression analysis

Expression Profiles of TSPAN5 in Different Tissues and Conditions

Tissue/Cell TypeTSPAN5 ExpressionChange in Pathological ConditionDetection MethodReference
Human HCC TissueOverexpressedUpregulated compared to normal liver tissueNot specified in current search results
Rat Hippocampal NeuronsPresent in both surface and intracellular poolsShift from 65% surface at DIV12 to 40% surface at DIV19BS3 crosslinking experiments
Dendritic SpinesEnrichedIntracellular pool increases upon neuronal maturationMicroscopy

These data tables compile key findings from the available research on TSPAN5, highlighting its diverse functions across different biological systems and providing a foundation for researchers designing studies with recombinant bovine TSPAN5.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.