Recombinant Bovine Tetraspanin-6 (TSPAN6)

What is the basic structure of Bovine TSPAN6?

Bovine TSPAN6 is a 245 amino acid protein characterized by four transmembrane domains, which is consistent with the typical tetraspanin family structure. The full-length recombinant protein sequence (1-245aa) is: MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIGTGTVIILLGTFGCFATCRASAWMLKLYAMFLTLIFLVELVAAIIGFVFRHEIKN SLKNNYEKALKQYNATGDYRSDAVDKIQSMLHCCGVTNYRDWKDTNYYSEKGFPESCCKL EDCSPQRDADKVNNEGCFIMVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV . The first transmembrane domain of TSPAN6 has been identified as particularly important for its ubiquitination and interaction with other proteins .

How is recombinant Bovine TSPAN6 typically produced for research?

Recombinant full-length Bovine TSPAN6 can be expressed in E. coli expression systems with an N-terminal His-tag for purification purposes. This approach allows for the production of the complete protein (amino acids 1-245) while facilitating easier purification through affinity chromatography methods . The recombinant protein is generally supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis .

What is the role of TSPAN6 in immune signaling pathways?

TSPAN6 functions as a negative regulator of the RIG-I-like receptor (RLR)-mediated signaling pathway, which is crucial for antiviral immune responses. Specifically, TSPAN6 inhibits the formation of the mitochondrial antiviral signaling (MAVS)-centered signalosome . Overexpression studies have shown that TSPAN6 impairs RLR-mediated activation of IFN-stimulated response elements, NF-κB, and IFN-β promoters, demonstrating its role in modulating innate immunity . Conversely, knockdown of TSPAN6 enhances the RLR-mediated signaling pathway, further confirming its inhibitory function .

How does TSPAN6 contribute to cancer development and progression?

Research indicates that TSPAN6 may function as a tumor suppressor in colorectal cancer (CRC). Expression analysis of genetically profiled colorectal adenocarcinomas has demonstrated that TSPAN6 expression is significantly reduced in tumors compared to adjacent non-cancerous tissues . Mechanistic studies using TSPAN6 knockout mice carrying the APCmin/+ allele showed that loss of TSPAN6 accentuates APC-driven tumorigenesis in vivo, resulting in increased numbers of intestinal and colonic polyps that were significantly larger in size and presented with more severe neoplastic phenotypes .

How does TSPAN6 interact with the MAVS signaling complex?

TSPAN6 strongly interacts with MAVS and weakly interacts with RIG-I, MDA5, and MITA, while showing no detectable interaction with TRAF3/6 or IRF3. Immunofluorescence assays have confirmed that TSPAN6 is partially co-localized with MAVS at mitochondria . Upon activation of the RLR pathway (e.g., by Sendai virus infection), TSPAN6 is recruited to mitochondria and its interaction with MAVS is enhanced . This interaction interferes with the recruitment of downstream molecules such as TRAF3, MITA, and IRF3 to MAVS, thereby inhibiting signal transduction .

What role does ubiquitination play in TSPAN6 function?

TSPAN6 undergoes Lys-63-linked ubiquitination when the RLR pathway is activated, but not Lys-48-linked ubiquitination . This post-translational modification is critical for TSPAN6's association with MAVS and its inhibitory effect on RLR signaling. Mutation studies have identified that Lys-11, Lys-18, and Lys-43 in the first transmembrane domain of TSPAN6 are critical ubiquitination sites . When these sites are mutated, both the ubiquitination of TSPAN6 and its binding to MAVS are severely impaired, reducing its inhibitory effect on MAVS-mediated activation of the IFN-β promoter .

What are the optimal storage and handling conditions for recombinant TSPAN6?

Recombinant TSPAN6 should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles, which are not recommended . Working aliquots can be stored at 4°C for up to one week . The protein is typically supplied in Tris/PBS-based buffer with 6% Trehalose, pH 8.0 . For reconstitution, it is recommended to briefly centrifuge the vial before opening to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How should recombinant TSPAN6 be reconstituted for experimental use?

For optimal results, recombinant TSPAN6 should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance stability during storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) and then aliquot for long-term storage at -20°C/-80°C . This approach helps maintain protein integrity and activity during storage periods.

How can researchers effectively study TSPAN6's role in cancer progression?

To study TSPAN6's role in cancer progression, researchers can employ several complementary approaches. The use of genetically modified mouse models, such as TSPAN6 knockout mice carrying cancer predisposition alleles (e.g., APCmin/+), has proven valuable for studying in vivo effects . Additionally, intestinal organoids derived from TSPAN6 knockout mice and colorectal cancer cell models (such as Caco-2) can be used to investigate TSPAN6's role in EGFR-dependent signaling in colonic epithelium . RNAseq analysis of polyps derived from control and TSPAN6 knockout animals can help identify pathways affected by TSPAN6 loss, with studies showing enrichment of differentially expressed genes within the MAPK signaling pathway .

What methodologies are appropriate for investigating TSPAN6's role in immune regulation?

For investigating TSPAN6's role in immune regulation, several methodological approaches have proven effective. Luciferase reporter assays using IFN-β, NF-κB, and ISRE promoter-reporters can measure the impact of TSPAN6 overexpression or knockdown on pathway activation . Co-immunoprecipitation assays are valuable for examining TSPAN6's interactions with components of the RLR pathway, such as MAVS . RNA interference techniques to knock down endogenous TSPAN6 can help analyze its impact on pathway activation upon stimulation with viral RNA, RIG-I, poly(I:C), or viruses like Sendai virus . Cell fractionation studies can investigate the subcellular distribution of TSPAN6 before and after stimulation, which has revealed recruitment to mitochondria after activation .

How does TSPAN6 regulate the production of extracellular vesicles?

Emerging research suggests that TSPAN6 regulates the production of extracellular vesicles (EVs) through interaction with the adapter protein syntenin-1, which is an established partner of TSPAN6 and plays a critical role in the biogenesis of multivesicular bodies (MVBs) and exosomal production . It has been hypothesized that the TSPAN6-syntenin-1 complex plays a critical role in suppressing colorectal tumorigenesis by controlling autocrine secretion of EGFR ligands via extracellular vesicles . This represents a novel mechanism through which TSPAN6 might influence intercellular communication and signaling.

What is the relationship between TSPAN6 and growth factor signaling in cancer?

TSPAN6 appears to play an important role in EGFR-dependent signaling in colonic epithelium, potentially via a pathway involving autocrine production of TGF-α . Research with intestinal organoids derived from TSPAN6 knockout mice and colorectal cancer cell models has confirmed this connection . Understanding TSPAN6-dependent mechanisms of EGFR regulation could potentially underpin further development of EGFR-targeting therapy and improve survival of colorectal cancer patients . This suggests that TSPAN6 may have broader implications for therapeutic approaches targeting growth factor signaling in cancer.

What are common pitfalls when working with recombinant TSPAN6 in experimental systems?

When working with recombinant TSPAN6, researchers may encounter several challenges. Repeated freeze-thaw cycles can lead to protein degradation and loss of activity, so proper aliquoting during initial reconstitution is essential . As a transmembrane protein, TSPAN6 may have solubility limitations in aqueous buffers, potentially requiring detergent-containing buffers for certain applications. Additionally, the proper folding of recombinant TSPAN6 expressed in prokaryotic systems like E. coli may not accurately represent the native conformation found in mammalian cells, potentially affecting functional studies. In such cases, expression in mammalian systems might be preferable for certain experimental questions.

How can researchers validate the functional activity of recombinant TSPAN6?

Validating the functional activity of recombinant TSPAN6 can be accomplished through several approaches. Co-immunoprecipitation assays can confirm the protein's ability to interact with known binding partners such as MAVS . In cell-based systems, transfection of recombinant TSPAN6 should demonstrate its inhibitory effect on RLR-mediated activation of IFN-β, ISRE, and NF-κB promoters using luciferase reporter assays . For structure-function studies, researchers can generate mutants (particularly affecting the first transmembrane domain) to confirm the importance of specific regions for TSPAN6's ubiquitination and interactions .